{ "uniprot_canonical_ac": "P0CX30-1", "uniprot_ac": "P0CX30", "uniprot_id": "RS23B_YEAST", "mass": { "chemical_mass": 16038.0, "monoisotopic_mass": 16038.0 }, "refseq": { "ac": "NP_011633", "name": "ribosomal 40S subunit protein S23A", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011633" }, "gene_names": [ { "name": "RPS23B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0CX30", "id": "P0CX30" }, { "name": "P9659.9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0CX30", "id": "P0CX30" }, { "name": "RPS28B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0CX30", "id": "P0CX30" } ], "protein_names": [ { "name": "Small ribosomal subunit protein uS12B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0CX30" }, { "name": "40S ribosomal protein S23-B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX30" }, { "name": "RP37", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX30" }, { "name": "S28", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX30" }, { "name": "YS14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CX30" }, { "name": "ribosomal 40S subunit protein S23A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011633", "id": "NP_011633" } ], "function": [ { "annotation": "Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30#function" }, { "database": "PubMed", "id": "22096102", "url": "https://glygen.org/publication/PubMed/22096102" } ] } ], "disease": [ { "disease_id": "DOID:0070415", "recommended_name": { "id": "DOID:0070415", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070415", "name": "brachycephaly, trichomegaly, and developmental delay", "description": "A syndrome characterized by brachycephaly, trichomegaly, and developmental delay, without anemia, that has_material_basis_in heterozygous mutation in the RPS23 gene on chromosome 5q14." }, "synonyms": [ { "id": "DOID:0070415", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070415", "name": "BTDD", "description": "" }, { "id": "DOID:0070415", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070415", "name": "MCINS", "description": "" }, { "id": "DOID:0070415", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070415", "name": "Macinnes syndrome", "description": "" }, { "id": "MONDO:0044311", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044311", "name": "brachycephaly, trichomegaly, and developmental delay", "description": "BTDD is an autosomal dominant disorder characterized by brachycephaly, trichomegaly, and developmental delay. Although it is caused by dysfunction of the ribosome, patients do not have anemia (summary by {2:Paolini et al., 2017})." }, { "id": "MONDO:0044311", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044311", "name": "brachycephaly, trichomegaly, and developmental delay", "description": "" }, { "id": "MONDO:0044311", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044311", "name": "BTDD", "description": "" }, { "id": "MONDO:0044311", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0044311", "name": "Macinnes syndrome", "description": "" }, { "id": "MIM:617412", "resource": "MIM", "url": "https://www.omim.org/entry/617412", "name": "Brachycephaly, trichomegaly, and developmental delay", "description": "Brachycephaly, trichomegaly, and developmental delay" } ], "evidence": [ { "id": "0070415", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070415" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 64, "end_pos": 64, "sequence_org": "P", "sequence_mut": "A", "comment": "Lethal mutation.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" }, { "database": "PubMed", "id": "24550462", "url": "https://glygen.org/publication/PubMed/24550462" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "N", "sequence_mut": "A", "comment": "Lethal mutation.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" }, { "database": "PubMed", "id": "24550462", "url": "https://glygen.org/publication/PubMed/24550462" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RPS23B", "url": "https://www.uniprot.org/uniprot/P0CX30", "locus": {} } ], "crossref": [ { "id": "cd03367", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03367", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "853015", "url": "https://www.ncbi.nlm.nih.gov/gene/853015", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "856250", "url": "https://www.ncbi.nlm.nih.gov/gene/856250", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005680", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005680", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006032", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006032", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YGR118W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR118W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "sce:YPR132W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR132W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "5480587at2759", "url": "http://www.orthodb.org/?query=5480587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11652", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11652", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11652:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11652:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00164", "url": "http://pfam.xfam.org/family/PF00164", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P0CX30", "url": "http://purl.obolibrary.org/obo/PR_P0CX30", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_011633", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_011633", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000006336", "url": "https://www.yeastgenome.org/locus/S000006336", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0CX30-1", "url": "https://www.uniprot.org/uniprot/P0CX30-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS", "length": 145, "header": "sp|P0CX30-1|RS23B_YEAST Isoform 1 of Small ribosomal subunit protein uS12B OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPS23B PE=1 SV=1 CANONICAL=P0CX30-1" }, "isoforms": [ { "isoform_ac": "P0CX30-1", "url": "", "sequence": { "sequence": "MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS", "length": 145, "header": "sp|P0CX30-1|RS23B_YEAST Isoform 1 of Small ribosomal subunit protein uS12B OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPS23B PE=1 SV=1 CANONICAL=P0CX30-1" }, "locus": { "chromosome": "VII", "start_pos": 727727, "end_pos": 726974, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR118W_mRNA", "url": "https://www.ensembl.org/id/YGR118W_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR118W", "url": "https://www.ensembl.org/id/YGR118W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 128, "end_pos": 128, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ], "site_lbl": "Ser128" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ], "site_lbl": "Ser40" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ], "site_lbl": "Ser41" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "Phosphoproteomic analysis reveals interconnected system-wide responses to perturbations of kinases and phosphatases in yeast.", "journal": "Science signaling", "date": "2010-12-21", "authors": "Bodenmiller Bernd, Wanka Stefanie, Kraft Claudine, Urban J\u00f6rg, Campbell David, Pedrioli Patrick G, Gerrits Bertran, Picotti Paola, Lam Henry, Vitek Olga, Brusniak Mi-Youn, Roschitzki Bernd, Zhang Chao, Shokat Kevan M, Schlapbach Ralph, Colman-Lerner Alejandro, Nolan Garry P, Nesvizhskii Alexey I, Peter Matthias, Loewith Robbie, von Mering Christian, Aebersold Ruedi", "evidence": [ { "database": "iPTMnet", "id": "P0CX30", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "21177495", "url": "https://glygen.org/publication/PubMed/21177495" } ] }, { "title": "The structure of the eukaryotic ribosome at 3.0 A resolution.", "journal": "Science", "date": "2011", "authors": "Jenner L., Yusupov M., Ben-Shem A., Garreau de Loubresse N., Melnikov S., Yusupova G.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "22096102", "url": "https://glygen.org/publication/PubMed/22096102" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "A new system for naming ribosomal proteins.", "journal": "Curr. Opin. Struct. Biol.", "date": "2014", "authors": "Ban N., Ramakrishnan V., Dinman J.D., Liljas A., Ortega J., Steitz T.A., Wilson D., Dragon F., Beckmann R., Warren A.J., Tollervey D., Lipton J.M., Tchorzewski M., Cate J.H.D., Ellis S.R., Lafontaine D.L.J., Lindahl L., McAlear M.A., Moore P.B., Noller H.F., Panse V.G., Spahn C.M.T., Williamson J.R., Yonath A., Yusupov M.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "24524803", "url": "https://glygen.org/publication/PubMed/24524803" } ] }, { "title": "Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Loenarz C, Sekirnik R, Thalhammer A, Ge W, Spivakovsky E, Mackeen MM, McDonough MA, Cockman ME, Kessler BM, Ratcliffe PJ, Wolf A, Schofield CJ", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "24550462", "url": "https://glygen.org/publication/PubMed/24550462" } ] }, { "title": "A novel cloning strategy reveals the gene for the yeast homologue to Escherichia coli ribosomal protein S12.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Warner J.R., Alksne L.E.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "8496146", "url": "https://glygen.org/publication/PubMed/8496146" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Davis K., Duesterhoeft A., Hillier L.W., Mewes H.-W., Pearson D., Schaefer M., Scharfe M., Wambutt R., Wang Y., Wedler H., Hall J., Bowman S., Chung E., Benes V., Botstein D., Brueckner M., Davis R.W., Lin A., Lin D., Duncan M., Barrell B.G., Rieger M., Ahmed A., Schroeder M., Oefner P., Delius H., Kleine K., Floeth M., Bussey H., Voss H., Lashkari D., Allen E., Dubois E., Hyman R.W., Aparicio A., Araujo R., Kalman S., Komp C., Kurdi O., Lew H., Namath A., Roberts D., Friesen J.D., Louis E.J., Johnston M., Pohl T.M., Schramm S., Cherry J.M., Badcock K., Churcher C.M., DiPaolo T., Dietrich F.S., Goffeau A., Hani J., Messenguy F., Mueller-Auer S., Rajandream M.A., Scherens B., Vissers S., Walsh S.V., Zollner A., Fortin N., Purnelle B., Sdicu A.-M., Storms R.K., Urrestarazu L.A., Vierendeels F., Vo D.H., Zhong W.-W., Albermann K., Carpenter J., Coster F., Fritz C., Hebling U., Heumann K., Hilbert H., Hunicke-Smith S., Marathe R., Mirtipati S., Moestl D., Nentwich U., Petel F.X., Rechmann S., Riles L., Tettelin H., Ushinsky S., Wedler E., Winnett E.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "9169875", "url": "https://glygen.org/publication/PubMed/9169875" } ] }, { "title": "The list of cytoplasmic ribosomal proteins of Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1998", "authors": "Mager W.H., Planta R.J.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "reference": [ { "type": "PubMed", "id": "9559554", "url": "https://glygen.org/publication/PubMed/9559554" } ] } ], "pathway": [ { "id": "sce:YGR118W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR118W", "resource": "KEGG Pathway" }, { "id": "sce:YPR132W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YPR132W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" }, { "name": "ribosome", "id": "GO:0005840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005840", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" }, { "name": "cytosolic small ribosomal subunit", "id": "GO:0022627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022627", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" }, { "name": "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)", "id": "GO:0000462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000462", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" }, { "name": "regulation of translational fidelity", "id": "GO:0006450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006450", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Hydroxylation at Pro-64 affects translation termination efficiency. The stereochemistry of the 3,4-dihydroxyproline has not yet been determined.", "evidence": [ { "database": "UniProtKB", "id": "P0CX30", "url": "https://www.uniprot.org/uniprot/P0CX30" }, { "database": "PubMed", "id": "24550462", "url": "https://glygen.org/publication/PubMed/24550462" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }