{ "uniprot_canonical_ac": "P0CL82-1", "uniprot_ac": "P0CL82", "uniprot_id": "GG12I_HUMAN", "mass": { "chemical_mass": 12978.0, "monoisotopic_mass": 12978.0 }, "refseq": { "ac": "NP_001091875", "name": "G antigen 12F", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875" }, "gene_names": [ { "name": "GAGE12I", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0CL82", "id": "P0CL82" } ], "protein_names": [ { "name": "G antigen 12I", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0CL82" }, { "name": "G antigen 12F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "id": "NP_001091875" }, { "name": "GAGE-12I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0CL82" }, { "name": "g antigen 12F/G/I; GAGE-12F; G antigen 7; G antigen 12G; G antigen 12I; Cancer/testis antigen 4.7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "id": "NP_001091875" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0CL82", "url": "https://www.uniprot.org/uniprot/P0CL82" } ], "common_name": "Human" } ], "gene": [ { "name": "GAGE12I", "url": "https://www.uniprot.org/uniprot/P0CL82", "locus": {} } ], "crossref": [ { "id": "GAGE12I", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE12I", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "100008586", "url": "https://www.ncbi.nlm.nih.gov/gene/100008586", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2579", "url": "https://www.ncbi.nlm.nih.gov/gene/2579", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "26748", "url": "https://www.ncbi.nlm.nih.gov/gene/26748", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "645073", "url": "https://www.ncbi.nlm.nih.gov/gene/645073", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4105", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4105", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0CL82", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0CL82*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100008586", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100008586", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:2579", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2579", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:26748", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26748", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:645073", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:645073", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_P0CL82", "url": "https://www.nextprot.org/entry/NX_P0CL82", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "4660048at2759", "url": "http://www.orthodb.org/?query=4660048at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05831", "url": "http://pfam.xfam.org/family/PF05831", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0CL82", "url": "https://pharos.nih.gov/targets/P0CL82", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0CL82", "url": "http://purl.obolibrary.org/obo/PR_P0CL82", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001091875", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091875", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0CL82", "url": "https://www.uniprot.org/uniprot/P0CL82", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0CL82-1", "url": "https://www.uniprot.org/uniprot/P0CL82-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|P0CL82-1|GG12I_HUMAN Isoform 1 of G antigen 12I OS=Homo sapiens OX=9606 GN=GAGE12I PE=1 SV=1 CANONICAL=P0CL82-1" }, "isoforms": [ { "isoform_ac": "P0CL82-1", "url": "", "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|P0CL82-1|GG12I_HUMAN Isoform 1 of G antigen 12I OS=Homo sapiens OX=9606 GN=GAGE12I PE=1 SV=1 CANONICAL=P0CL82-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.", "journal": "Tissue Antigens", "date": "2008", "authors": "Ditzel H.J., Gjerstorff M.F.", "evidence": [ { "database": "UniProtKB", "id": "P0CL82", "url": "https://www.uniprot.org/uniprot/P0CL82" } ], "reference": [ { "type": "PubMed", "id": "18179644", "url": "https://glygen.org/publication/PubMed/18179644" } ] }, { "title": "Expression, purification and characterization of the cancer-germline antigen GAGE12I: a candidate for cancer immunotherapy.", "journal": "Protein Expr. Purif.", "date": "2010", "authors": "Ditzel H.J., Larsen M.R., Gjerstorff M.F., Besir H.", "evidence": [ { "database": "UniProtKB", "id": "P0CL82", "url": "https://www.uniprot.org/uniprot/P0CL82" } ], "reference": [ { "type": "PubMed", "id": "20546897", "url": "https://glygen.org/publication/PubMed/20546897" } ] } ], "pathway": [ { "id": "hsa:100008586", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100008586", "resource": "KEGG Pathway" }, { "id": "hsa:2579", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2579", "resource": "KEGG Pathway" }, { "id": "hsa:26748", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26748", "resource": "KEGG Pathway" }, { "id": "hsa:645073", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:645073", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }