{ "uniprot_canonical_ac": "P0C268-1", "uniprot_ac": "P0C268", "uniprot_id": "YB39B_YEAST", "mass": { "chemical_mass": 6873.0, "monoisotopic_mass": 6873.0 }, "refseq": { "ac": "NP_878045", "name": "Min6p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878045" }, "gene_names": [ { "name": "MIN6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878045", "id": "NP_878045" }, { "name": "YBL039W-A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878045", "id": "NP_878045" } ], "protein_names": [ { "name": "Uncharacterized protein YBL039W-B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0C268" }, { "name": "Min6p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878045", "id": "NP_878045" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/P0C268", "locus": {} } ], "crossref": [ { "id": "1466441", "url": "https://www.ncbi.nlm.nih.gov/gene/1466441", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P0C268", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0C268*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "sce:YBL039W-B", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL039W-B", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "STIAMWV", "url": "https://omabrowser.org/oma/group/STIAMWV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2008933at2759", "url": "http://www.orthodb.org/?query=2008933at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_P0C268", "url": "http://purl.obolibrary.org/obo/PR_P0C268", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_878045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878045", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028517", "url": "https://www.yeastgenome.org/locus/S000028517", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C268-1", "url": "https://www.uniprot.org/uniprot/P0C268-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGFFNNNPVIEFFHRITRKPSTIAMWVFAGLICSSTFYLMFMSSPTIDFNSKSKKKNDK", "length": 59, "header": "sp|P0C268-1|YB39B_YEAST Isoform 1 of Uncharacterized protein YBL039W-B OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=4 SV=1 CANONICAL=P0C268-1" }, "isoforms": [ { "isoform_ac": "P0C268-1", "url": "", "sequence": { "sequence": "MGFFNNNPVIEFFHRITRKPSTIAMWVFAGLICSSTFYLMFMSSPTIDFNSKSKKKNDK", "length": 59, "header": "sp|P0C268-1|YB39B_YEAST Isoform 1 of Uncharacterized protein YBL039W-B OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=4 SV=1 CANONICAL=P0C268-1" }, "locus": { "chromosome": "II", "start_pos": 143569, "end_pos": 143393, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YBL039W-B_mRNA", "url": "https://www.ensembl.org/id/YBL039W-B_mRNA" }, { "database": "Ensembl Peptide", "id": "YBL039W-B", "url": "https://www.ensembl.org/id/YBL039W-B" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii.", "journal": "Genome Biol.", "date": "2003", "authors": "Zhang Z., Philippsen P., Stuart L., Dietrich F.S., Brachat S., Gaffney T.D., Gates K., Lerch A., Voegeli S.", "evidence": [ { "database": "UniProtKB", "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268" } ], "reference": [ { "type": "PubMed", "id": "12844361", "url": "https://glygen.org/publication/PubMed/12844361" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Complete DNA sequence of yeast chromosome II.", "journal": "EMBO J.", "date": "1994", "authors": "Gassenhuber J., Mewes H.-W., Obermaier B., Stucka R., Rose M., Wagner G., Boles E., Brueckner M., Jacquet M., Rieger M., Mueller S., Molemans F., Zagulski M., Brandt T., Christiansen C., Barthe C., Feldmann H., Kleine K., Cziepluch C., Fiers W., Mallet L., Jauniaux J.-C., Dubois E., Andre B., Li Z.Y., Koetter P., Hein C., Entian K.-D., Slonimski P.P., Vetter I., Nasr F., Louis E.J., Delaveau T., Hollenberg C.P., Contreras R., Domdey H., Pohl T.M., Brendel M., Becam A.-M., Bussereau F., Crouzet M., Doignon F., Dujon B., El Bakkoury M., Feuermann M., Glansdorff N., Goffeau A., Grivell L.A., Herbert C.J., Jacq C., Mannhaupt G., Messenguy F., Miosga T., Perea J., Pierard A., Potier S., Proft M., Schaaff-Gerstenschlaeger I., Scherens B., Souciet J.-L., Steensma H.Y., Vissers S., Zimmermann F.K., Aljinovic G., Duesterhus S., Jonniaux J.-L., Kirchrath L., Purnelle B., Ramezani Rad M., Skala J., Urrestarazu L.A., Vierendeels F., de Wergifosse P., Aigle M., Baclet M.C., Baur A., Biteau N., Demolis N., Fobo G.M., Fritz C., Holmstroem K., Kallesoee T., Kiesau P., Korol S., Liebl S., Logghe M., Lohan A.J.E., Maat M.J., Piravandi E., Pohl F.M., Schwarzlose C., Smits P.H.M., Van Dyck L., Vassarotti A., Wolfe K.H., de Haan M., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268" } ], "reference": [ { "type": "PubMed", "id": "7813418", "url": "https://glygen.org/publication/PubMed/7813418" } ] } ], "pathway": [ { "id": "sce:YBL039W-B", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YBL039W-B", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "P0C268", "url": "https://www.uniprot.org/uniprot/P0C268" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }