{ "uniprot_canonical_ac": "P09405-1", "uniprot_ac": "P09405", "uniprot_id": "NUCL_MOUSE", "mass": { "chemical_mass": 76723.0, "monoisotopic_mass": 76723.0 }, "refseq": { "ac": "NP_035010", "name": "nucleolin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" }, "gene_names": [ { "name": "Ncl", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09405", "id": "P09405" }, { "name": "B530004O11Rik; C23; D0Nds28; D1Nds28; Nucl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010", "id": "NP_035010" }, { "name": "Ncl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010", "id": "NP_035010" }, { "name": "Nuc", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09405", "id": "P09405" } ], "protein_names": [ { "name": "Nucleolin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09405" }, { "name": "Protein C23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09405" }, { "name": "nucleolin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010", "id": "NP_035010" } ], "function": [ { "annotation": "Growth Factor Midkine Aggravates Pulmonary Arterial Hypertension via Surface Nucleolin. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" }, { "database": "PubMed", "id": "32587339", "url": "https://glygen.org/publication/PubMed/32587339" } ] }, { "annotation": "NUCLEOLIN PROTECTS CARDIOMYOCYTES BY UPREGULATING PGC-1alpha AND PROMOTING MITOCHONDRIAL BIOGENESIS IN LPS-INDUCED MYOCARDIAL INJURY.", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" }, { "database": "PubMed", "id": "36680791", "url": "https://glygen.org/publication/PubMed/36680791" } ] }, { "annotation": "Nucleolin is the major nucleolar protein of growing eukaryotic cells. It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in pre-rRNA transcription and ribosome assembly. May play a role in the process of transcriptional elongation. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405#function" }, { "database": "PubMed", "id": "8065340", "url": "https://glygen.org/publication/PubMed/8065340" } ] }, { "annotation": "The glycine arginine-rich domain of the RNA-binding protein nucleolin regulates its subcellular localization.", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" }, { "database": "PubMed", "id": "34515347", "url": "https://glygen.org/publication/PubMed/34515347" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ncl", "url": "https://www.uniprot.org/uniprot/P09405", "locus": { "chromosome": "1", "start_pos": 86272441, "end_pos": 86287122, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000026234", "url": "https://www.ensembl.org/id/ENSMUSG00000026234" } ] } } ], "crossref": [ { "id": "ENSMUSG00000026234", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026234", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12403", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12403", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12404", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12404", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12405", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12405", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12406", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12406", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "17975", "url": "https://www.ncbi.nlm.nih.gov/gene/17975", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P09405", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09405*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034230", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034230", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034233", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034233", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034234", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034234", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:17975", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17975", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "97286", "url": "http://www.informatics.jax.org/marker/MGI:97286", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YVQYSSV", "url": "https://omabrowser.org/oma/group/YVQYSSV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5482496at2759", "url": "http://www.orthodb.org/?query=5482496at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48025", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48025", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48025:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48025:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P09405", "url": "http://purl.obolibrary.org/obo/PR_P09405", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6791226", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6791226", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WRM5", "url": "https://www.uniprot.org/uniprot/A0A087WRM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WRM5-1", "url": "https://www.uniprot.org/uniprot/A0A087WRM5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09405-1", "url": "https://www.uniprot.org/uniprot/P09405-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE", "length": 707, "header": "sp|P09405-1|NUCL_MOUSE Isoform 1 of Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=2 CANONICAL=P09405-1" }, "isoforms": [ { "isoform_ac": "A0A087WRM5-1", "url": "", "sequence": { "sequence": "MAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVAT", "length": 76, "header": "tr|A0A087WRM5-1|A0A087WRM5_MOUSE Computationally mapped isoform of Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=1 CANONICAL=P09405-1" }, "locus": { "chromosome": "1", "start_pos": 86285915, "end_pos": 86285034, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000185785.2", "url": "https://www.ensembl.org/id/ENSMUST00000185785.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000140696.2", "url": "https://www.ensembl.org/id/ENSMUSP00000140696.2" } ] } }, { "isoform_ac": "P09405-1", "url": "", "sequence": { "sequence": "MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVPTPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPAKAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKVEGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE", "length": 707, "header": "sp|P09405-1|NUCL_MOUSE Isoform 1 of Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=2 CANONICAL=P09405-1" }, "locus": { "chromosome": "1", "start_pos": 86286945, "end_pos": 86278345, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000027438", "url": "https://www.ensembl.org/id/ENSMUST00000027438" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000027438", "url": "https://www.ensembl.org/id/ENSMUSP00000027438" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P09405", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" }, { "id": "21540332", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21540332" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" }, { "id": "22645316", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22645316" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" } ] } ], "phosphorylation": [ { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr106" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr121" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "17622165", "url": "https://glygen.org/publication/PubMed/17622165" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ], "site_lbl": "Ser145" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "17622165", "url": "https://glygen.org/publication/PubMed/17622165" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" }, { "database": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ], "site_lbl": "Ser157" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser189" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser212" }, { "start_pos": 220, "end_pos": 220, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr220" }, { "start_pos": 28, "end_pos": 28, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser28" }, { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser303" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser34" }, { "start_pos": 358, "end_pos": 358, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Ser358" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr369" }, { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser403" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr407" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser40" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "P09405", "url": "http://phospho.elm.eu.org/byAccession/P09405.html" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser41" }, { "start_pos": 460, "end_pos": 460, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser460" }, { "start_pos": 462, "end_pos": 462, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Ser462" }, { "start_pos": 577, "end_pos": 577, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Ser577" }, { "start_pos": 588, "end_pos": 588, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Ser588" }, { "start_pos": 616, "end_pos": 616, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "site_lbl": "Ser616" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Ser67" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr69" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr76" }, { "start_pos": 84, "end_pos": 84, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr84" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr92" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "site_lbl": "Thr99" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Phosphoproteomic analysis of the developing mouse brain.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "reference": [ { "type": "PubMed", "id": "15345747", "url": "https://glygen.org/publication/PubMed/15345747" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "UniProtKB", "id": "A0A087WRM5", "url": "https://www.uniprot.org/uniprot/A0A087WRM5" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "A differential phosphoproteomic analysis of retinoic acid-treated P19 cells.", "journal": "Journal of proteome research", "date": "2007", "authors": "Smith JC, Duchesne MA, Tozzi P, Ethier M, Figeys D", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "reference": [ { "type": "PubMed", "id": "17622165", "url": "https://glygen.org/publication/PubMed/17622165" } ] }, { "title": "Granzyme A binding to target cell proteins. Granzyme A binds to and cleaves nucleolin in vitro.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Pasternack M.S., Bleier K.J., McInerney T.N.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "1860869", "url": "https://glygen.org/publication/PubMed/1860869" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "UniProtKB", "id": "A0A087WRM5", "url": "https://www.uniprot.org/uniprot/A0A087WRM5" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.", "journal": "Cell", "date": "2009", "authors": "Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "19524510", "url": "https://glygen.org/publication/PubMed/19524510" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "iPTMnet", "id": "P09405", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09405" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Structure and function of the N-terminal nucleolin binding domain of nuclear valosin-containing protein-like 2 (NVL2) harboring a nucleolar localization signal.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Shirakawa M., Fujiwara Y., Fujiwara K., Hiroaki H., Goda N., Iwaya N., Tenno T.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "21474449", "url": "https://glygen.org/publication/PubMed/21474449" } ] }, { "title": "Histone chaperone Spt6 is required for class switch recombination but not somatic hypermutation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2011", "authors": "Okazaki IM, Okawa K, Kobayashi M, Yoshikawa K, Kawamoto S, Nagaoka H, Shinkura R, Kitawaki Y, Taniguchi H, Natsume T, Iemura S, Honjo T", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "21518874", "url": "https://glygen.org/publication/PubMed/21518874" } ] }, { "title": "Chemical reporters for fluorescent detection and identification of O-GlcNAc-modified proteins reveal glycosylation of the ubiquitin ligase NEDD4-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Zaro BW, Yang YY, Hang HC, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" } ], "reference": [ { "type": "PubMed", "id": "21540332", "url": "https://glygen.org/publication/PubMed/21540332" } ] }, { "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" } ], "reference": [ { "type": "PubMed", "id": "22645316", "url": "https://glygen.org/publication/PubMed/22645316" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Mol. Cell. Proteomics", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells.", "journal": "Stem Cells Dev.", "date": "2014", "authors": "Luhrig S, Siamishi I, Tesmer-Wolf M, Zechner U, Engel W, Nolte J", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "24991885", "url": "https://glygen.org/publication/PubMed/24991885" } ] }, { "title": "Zbtb7b engages the long noncoding RNA Blnc1 to drive brown and beige fat development and thermogenesis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2017", "authors": "Li S, Mi L, Yu L, Yu Q, Liu T, Wang GX, Zhao XY, Wu J, Lin JD", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "28784777", "url": "https://glygen.org/publication/PubMed/28784777" } ] }, { "title": "Sequence and structure of the nucleolin promoter in rodents: characterization of a strikingly conserved CpG island.", "journal": "Gene", "date": "1988", "authors": "Bourbon HM, Prudhomme M, Amalric F", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "2906027", "url": "https://glygen.org/publication/PubMed/2906027" } ] }, { "title": "Structure of the mouse nucleolin gene. The complete sequence reveals that each RNA binding domain is encoded by two independent exons.", "journal": "J. Mol. Biol.", "date": "1988", "authors": "Lapeyre B., Amalric F., Bourbon H.-M.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "3137346", "url": "https://glygen.org/publication/PubMed/3137346" } ] }, { "title": "Growth Factor Midkine Aggravates Pulmonary Arterial Hypertension via Surface Nucleolin.", "journal": "Scientific reports", "date": "2020", "authors": "Kinoshita D, Shishido T, Takahashi T, Yokoyama M, Sugai T, Watanabe K, Tamura H, Nishiyama S, Takahashi H, Arimoto T, Miyamoto T, Watanabe T, Kishida S, Kadomatsu K, Abe JI, Takeishi Y, Konta T, Kubota I, Watanabe M", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" } ], "reference": [ { "type": "PubMed", "id": "32587339", "url": "https://glygen.org/publication/PubMed/32587339" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "The glycine arginine-rich domain of the RNA-binding protein nucleolin regulates its subcellular localization.", "journal": "The EMBO journal", "date": "2021", "authors": "Doron-Mandel E, Koppel I, Abraham O, Rishal I, Smith TP, Buchanan CN, Sahoo PK, Kadlec J, Oses-Prieto JA, Kawaguchi R, Alber S, Zahavi EE, Di Matteo P, Di Pizio A, Song DA, Okladnikov N, Gordon D, Ben-Dor S, Haffner-Krausz R, Coppola G, Burlingame AL, Jungwirth P, Twiss JL, Fainzilber M", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" } ], "reference": [ { "type": "PubMed", "id": "34515347", "url": "https://glygen.org/publication/PubMed/34515347" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09405", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09405" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] }, { "title": "NUCLEOLIN PROTECTS CARDIOMYOCYTES BY UPREGULATING PGC-1\u03b1 AND PROMOTING MITOCHONDRIAL BIOGENESIS IN LPS-INDUCED MYOCARDIAL INJURY.", "journal": "Shock (Augusta, Ga.)", "date": "2023-04-01", "authors": "Yin Leijing, Tang Yuting, Luo Zhengyang, Yuan Ludong, Lin Xiaofang, Wang Shuxin, Liang Pengfei, Jiang Bimei", "evidence": [ { "database": "RefSeq", "id": "NP_035010", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035010" } ], "reference": [ { "type": "PubMed", "id": "36680791", "url": "https://glygen.org/publication/PubMed/36680791" } ] }, { "title": "Purification and characterization of nucleolin and its identification as a transcription repressor.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Lee Y.-M., Lai M.-Y., Lee S.-C., Yeh N.-H., Chen D.-S., Lei H.-Y., Tsai W.-H., Yang T.-H.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "8065340", "url": "https://glygen.org/publication/PubMed/8065340" } ] }, { "title": "A B-cell-specific DNA recombination complex.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Wabl M., Akhmedov A.T., Borggrefe T., Jessberger R.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "reference": [ { "type": "PubMed", "id": "9642267", "url": "https://glygen.org/publication/PubMed/9642267" } ] } ], "pathway": [ { "id": "mmu:17975", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17975", "resource": "KEGG Pathway" }, { "id": "R-MMU-6791226", "name": "Major pathway of rRNA processing in the nucleolus and cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6791226", "resource": "Reactome", "description": "Major pathway of rRNA processing in the nucleolus and cytosol" } ], "orthologs": [ { "uniprot_canonical_ac": "P13383-1", "protein_name": "Nucleolin", "gene_name": "Ncl", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVKLAKAGKTHGESKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTPAKKVVVSQTKKAAVPTPAKKAAVTPGKKAAATPAKKAVTPAKVVPTPGKKGAAQAKALVPTPGKKGAVTPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDEEDEFEPPVVKGVKPAKAAPAAPASEDEDEEDDDDEDDDDDDEEEEEEDDSEEEVMEITPAKGKKTPAKVVPVKAKSVAEEEEDDEDDEDEEEDEDEEDEEDDEDEDEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKIEGSEPTTPFNLFIGNLNPNKSVAELKVAISELFAKNDLAAVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAVEIRLVSQDGRSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNPHGKSKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE", "length": 713 }, "evidence": [ { "id": "45231702", "url": "http://www.informatics.jax.org/homology/45231702", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P19338-1", "protein_name": "Nucleolin", "gene_name": "NCL", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE", "length": 710 }, "evidence": [ { "id": "45231702", "url": "http://www.informatics.jax.org/homology/45231702", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "negative regulation of insulin receptor signaling pathway", "id": "GO:0046627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046627", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "positive regulation of mRNA splicing, via spliceosome", "id": "GO:0048026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048026", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "regulation of rRNA processing", "id": "GO:2000232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000232", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "endocytosis", "id": "GO:0006897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006897", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050730", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cellular response to epidermal growth factor stimulus", "id": "GO:0071364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071364", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "positive regulation of transcription of nucleolar large rRNA by RNA polymerase I", "id": "GO:1901838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901838", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "selenocysteine insertion sequence binding", "id": "GO:0035368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035368", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "laminin binding", "id": "GO:0043236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043236", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "telomeric DNA binding", "id": "GO:0042162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042162", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "DNA topoisomerase binding", "id": "GO:0044547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044547", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "insulin receptor substrate binding", "id": "GO:0043560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043560", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "mRNA 5'-UTR binding", "id": "GO:0048027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048027", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "PH domain binding", "id": "GO:0042731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042731", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "rRNA primary transcript binding", "id": "GO:0042134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042134", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "ErbB-4 class receptor binding", "id": "GO:1990631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990631", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "spliceosomal complex", "id": "GO:0005681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005681", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cytoplasmic ribonucleoprotein granule", "id": "GO:0036464", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036464", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "cornified envelope", "id": "GO:0001533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001533", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" }, { "name": "dense fibrillar component", "id": "GO:0001651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001651", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 319, "end_pos": 321, "annotation": "n_glycosylation_sequon" }, { "start_pos": 401, "end_pos": 403, "annotation": "n_glycosylation_sequon" }, { "start_pos": 405, "end_pos": 407, "annotation": "n_glycosylation_sequon" }, { "start_pos": 493, "end_pos": 495, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Symmetrically methylated by PRMT5.", "evidence": [ { "database": "UniProtKB", "id": "P09405", "url": "https://www.uniprot.org/uniprot/P09405" }, { "database": "PubMed", "id": "P19338", "url": "https://glygen.org/publication/PubMed/P19338" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 27 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }