{ "uniprot_canonical_ac": "P09089-1", "uniprot_ac": "P09089", "uniprot_id": "ZEN1_DROME", "mass": { "chemical_mass": 39302.0, "monoisotopic_mass": 39302.0 }, "refseq": { "ac": "NP_476793", "name": "zerknullt", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793" }, "gene_names": [ { "name": "zen", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09089", "id": "P09089" }, { "name": "BG:DS00276.9; CG1046; dm-zen; Dmel\\CG1046; l(3)84Ad; z1; Zen; ZEN; ZEN VRE; zen1; Zen1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793", "id": "NP_476793" }, { "name": "CG1046", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09089", "id": "P09089" }, { "name": "z1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09089", "id": "P09089" }, { "name": "zen1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09089", "id": "P09089" }, { "name": "zen", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793", "id": "NP_476793" } ], "protein_names": [ { "name": "Protein zerknuellt 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09089" }, { "name": "CG1046-PA; zen-PA; zerknullt 1; zerknuellt; zerknult", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793", "id": "NP_476793" }, { "name": "ZEN-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09089" }, { "name": "zerknullt", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793", "id": "NP_476793" } ], "function": [ { "annotation": "Required for the differentiation of the dorsal-ventral pattern, and does not appear to be involved in the process of segmentation.", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089#function" }, { "database": "PubMed", "id": "2892759", "url": "https://glygen.org/publication/PubMed/2892759" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "zen", "url": "https://www.uniprot.org/uniprot/P09089", "locus": { "chromosome": "3R", "start_pos": 6752864, "end_pos": 6754194, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0004053", "url": "https://www.ensembl.org/id/FBgn0004053" } ] } } ], "crossref": [ { "id": "FBgn0004053", "url": "https://bgee.org/?page=gene&gene_id=FBgn0004053", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0004053", "url": "https://flybase.org/reports/FBgn0004053", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40828", "url": "https://www.ncbi.nlm.nih.gov/gene/40828", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P09089", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09089*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020479", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020479", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG1046", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1046", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YYPVHQP", "url": "https://omabrowser.org/oma/group/YYPVHQP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "912260at2759", "url": "http://www.orthodb.org/?query=912260at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45664", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45664", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45664:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45664:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1KZ2", "url": "https://www.rcsb.org/structure/1KZ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P09089", "url": "http://purl.obolibrary.org/obo/PR_P09089", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_476793", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_476793", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09089-1", "url": "https://www.uniprot.org/uniprot/P09089-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTSYNYPN", "length": 353, "header": "sp|P09089-1|ZEN1_DROME Isoform 1 of Protein zerknuellt 1 OS=Drosophila melanogaster OX=7227 GN=zen PE=1 SV=1 CANONICAL=P09089-1" }, "isoforms": [ { "isoform_ac": "P09089-1", "url": "", "sequence": { "sequence": "MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTSYNYPN", "length": 353, "header": "sp|P09089-1|ZEN1_DROME Isoform 1 of Protein zerknuellt 1 OS=Drosophila melanogaster OX=7227 GN=zen PE=1 SV=1 CANONICAL=P09089-1" }, "locus": { "chromosome": "3R", "start_pos": 6754148, "end_pos": 6753026, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0081670", "url": "https://www.ensembl.org/id/FBtr0081670" }, { "database": "Ensembl Peptide", "id": "FBpp0081170", "url": "https://www.ensembl.org/id/FBpp0081170" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Molecular characterization of the zerknullt region of the Antennapedia gene complex in Drosophila.", "journal": "Genes Dev.", "date": "1987", "authors": "Hoey T., Levine M., Doyle H., Rushlow C.", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "reference": [ { "type": "PubMed", "id": "2892759", "url": "https://glygen.org/publication/PubMed/2892759" } ] } ], "pathway": [ { "id": "dme:Dmel_CG1046", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG1046", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "compound eye development", "id": "GO:0048749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048749", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" }, { "name": "amnioserosa formation", "id": "GO:0007378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007378", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P09089", "url": "https://www.uniprot.org/uniprot/P09089" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }