{ "uniprot_canonical_ac": "P07285-1", "uniprot_ac": "P07285", "uniprot_id": "TRPD_YEAST", "mass": { "chemical_mass": 41374.0, "monoisotopic_mass": 41374.0 }, "refseq": { "ac": "NP_010641", "name": "anthranilate phosphoribosyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010641" }, "gene_names": [ { "name": "TRP4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07285", "id": "P07285" }, { "name": "D9476.4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07285", "id": "P07285" }, { "name": "TRP4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010641", "id": "NP_010641" } ], "protein_names": [ { "name": "Anthranilate phosphoribosyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07285" }, { "name": "2.4.2.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07285" }, { "name": "PRtransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07285" }, { "name": "anthranilate phosphoribosyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010641", "id": "NP_010641" } ], "function": [ { "annotation": "Catalyzes the transfer of the phosphoribosyl group of 5-phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA), the second step in tryptophan biosynthesis.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285#function" }, { "database": "PubMed", "id": "2428012", "url": "https://glygen.org/publication/PubMed/2428012" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "common_name": "Yeast" } ], "gene": [ { "name": "TRP4", "url": "https://www.uniprot.org/uniprot/P07285", "locus": {} } ], "crossref": [ { "id": "851956", "url": "https://www.ncbi.nlm.nih.gov/gene/851956", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P07285", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07285*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000312", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000312", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005940", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005940", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017459", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017459", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035902", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035902", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YDR354W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR354W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GPMTNPA", "url": "https://omabrowser.org/oma/group/GPMTNPA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2786267at2759", "url": "http://www.orthodb.org/?query=2786267at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43285", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43285", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43285:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43285:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7DSJ", "url": "https://www.rcsb.org/structure/7DSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DSM", "url": "https://www.rcsb.org/structure/7DSM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DSO", "url": "https://www.rcsb.org/structure/7DSO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DSP", "url": "https://www.rcsb.org/structure/7DSP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DSR", "url": "https://www.rcsb.org/structure/7DSR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00591", "url": "http://pfam.xfam.org/family/PF00591", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02885", "url": "http://pfam.xfam.org/family/PF02885", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P07285", "url": "http://purl.obolibrary.org/obo/PR_P07285", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_010641", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_010641", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000002762", "url": "https://www.yeastgenome.org/locus/S000002762", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07285-1", "url": "https://www.uniprot.org/uniprot/P07285-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSEATLLSYTKKLLASPPQLSSTDLHDALLVILSLLQKCDTNSDESLSIYTKVSSFLTALRVTKLDHKAEYIAEAAKAVLRHSDLVDLPLPKKDELHPEDGPVILDIVGTGGDGQNTFNVSTSAAIVASGIQGLKICKHGGKASTSNSGAGDLIGTLGCDMFKVNSSTVPKLWPDNTFMFLLAPFFHHGMGHVSKIRKFLGIPTVFNVLGPLLHPVSHVNKRILGVYSKELAPEYAKAAALVYPGSETFIVWGHVGLDEVSPIGKTTVWHIDPTSSELKLKTFQLEPSMFGLEEHELSKCASYGPKENARILKEEVLSGKYHLGDNNPIYDYILMNTAVLYCLSQGHQNWKEGIIKAEESIHSGNALRSLEHFIDSVSSL", "length": 380, "header": "sp|P07285-1|TRPD_YEAST Isoform 1 of Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae S288C OX=559292 GN=TRP4 PE=1 SV=1 CANONICAL=P07285-1" }, "isoforms": [ { "isoform_ac": "P07285-1", "url": "", "sequence": { "sequence": "MSEATLLSYTKKLLASPPQLSSTDLHDALLVILSLLQKCDTNSDESLSIYTKVSSFLTALRVTKLDHKAEYIAEAAKAVLRHSDLVDLPLPKKDELHPEDGPVILDIVGTGGDGQNTFNVSTSAAIVASGIQGLKICKHGGKASTSNSGAGDLIGTLGCDMFKVNSSTVPKLWPDNTFMFLLAPFFHHGMGHVSKIRKFLGIPTVFNVLGPLLHPVSHVNKRILGVYSKELAPEYAKAAALVYPGSETFIVWGHVGLDEVSPIGKTTVWHIDPTSSELKLKTFQLEPSMFGLEEHELSKCASYGPKENARILKEEVLSGKYHLGDNNPIYDYILMNTAVLYCLSQGHQNWKEGIIKAEESIHSGNALRSLEHFIDSVSSL", "length": 380, "header": "sp|P07285-1|TRPD_YEAST Isoform 1 of Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae S288C OX=559292 GN=TRP4 PE=1 SV=1 CANONICAL=P07285-1" }, "locus": { "chromosome": "IV", "start_pos": 1185886, "end_pos": 1184747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YDR354W_mRNA", "url": "https://www.ensembl.org/id/YDR354W_mRNA" }, { "database": "Ensembl Peptide", "id": "YDR354W", "url": "https://www.ensembl.org/id/YDR354W" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "The TRP4 gene of Saccharomyces cerevisiae: isolation and structural analysis.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Aebi M., Prantl F., Braus G., Furter R., Huetter R., Niederberger P., Paravicini G.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "2428012", "url": "https://glygen.org/publication/PubMed/2428012" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Crystal structures of anthranilate phosphoribosyltransferase from Saccharomyces cerevisiae.", "journal": "Acta Crystallogr. F Struct. Biol. Commun.", "date": "2021", "authors": "Wu X., Zhang M., Zhu Z., Zhu M., Xue L., Yue J., Kuang Z., Niu L., Khan M.H.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "33682790", "url": "https://glygen.org/publication/PubMed/33682790" } ] }, { "title": "A spacer protein in the Saccharomyces cerevisiae spindle poly body whose transcript is cell cycle-regulated.", "journal": "J. Cell Biol.", "date": "1993", "authors": "Finch J.T., Kilmartin J.V., Dyos S.L., Kershaw D.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "7503995", "url": "https://glygen.org/publication/PubMed/7503995" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.", "journal": "Nature", "date": "1997", "authors": "Andrews S., Bahr A., Bloecker H., Brandt P., Connor R., Du Z., Fulton L., Gentles S., Hawkins J., Hillier L.W., Johnson D., Latreille P., Mardis E., Mewes H.-W., Miller N., Niblett D., Oliver K., Schaefer M., Scharfe M., Vaudin M., Wambutt R., Waterston R., Wedler H., Wilson R., Chen E., Le T., Verhasselt P., Bowman S., Hunt S., Wagner G., Chung E., Nakahara K., Botstein D., Brueckner M., Davis R.W., Lin D., Hankeln T., Schneider C., Schmidt E.R., Duncan M., Favello A., Kucaba T., Rifkin L., Trevaskis E., Wohldman P., Barrell B.G., Rieger M., Berno A., Schroeder M., Ding H., Oh C., Oefner P., Schwarz S., Woelfl S., Kleine K., Becker A., Prydz H., Cooper J., Arnold W., Eide L.G., Kraemer C., Lashkari D., Allen E., Jimenez A., Kuester H., Hoheisel J.D., Pauley A., Paulin L., Brown D., Jaeger W., Volckaert G., Hyman R.W., Andre B., Perez-Alonso M., Araujo R., Komp C., Lew H., Namath A., Roberts D., Paricio N., Boskovic J., Louis E.J., Mulligan J.T., Delaveau T., Greco T., Johnston L., Nhan M., Jones L., Odell C., Menezes S., Johnston M., Pohl T.M., Harris D.E., Schramm S., McDonald S., Salom D., Bargues M., Cherry J.M., Ballesta J.P.G., Churcher C.M., Dedman K., Dietrich F.S., Dujon B., Goffeau A., Hamlin N., Hani J., Jacq C., Mueller-Auer S., Perea J., Perez-Ortin J.E., Rajandream M.A., Remacha M.A., Revuelta J.L., Vissers S., Walsh S.V., Zollner A., del Rey F., Jonniaux J.-L., Purnelle B., Saiz J.E., Urrestarazu L.A., Voet M., Wilcox L., Albermann K., Alt-Moerbe J., Aviles E., Baron L., Biteau N., Blugeon C., Brinkman R., Buitrago M.J., Carpenter J., Coster F., Garcia-Cantalejo J.M., Gattung S., Gomez-Peris A., Granotier C., Hallsworth K., Hanemann V., Heumann K., Hunicke-Smith S., Jier M., Kirsten J., Laamanen P., Langston Y., Legros Y., Moeller-Rieker S., Monnet A., Moro M., Mosedale D., Murphy L.D., Nussbaumer B., Peluso D., Petel F.X., Rasmussen S.W., Richards C., Riles L., Saluz H.P., Saren A.-M., Scholler P., Shogren T., Shore L., Shroff N., Soler-Mira A., Taich A., Vignati D., Wedler E., Winant A., Yelton M.A., Zaccaria P.", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "reference": [ { "type": "PubMed", "id": "9169867", "url": "https://glygen.org/publication/PubMed/9169867" } ] } ], "pathway": [ { "id": "sce:YDR354W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YDR354W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "anthranilate phosphoribosyltransferase activity", "id": "GO:0004048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004048", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "tryptophan biosynthetic process", "id": "GO:0000162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000162", "evidence": [ { "database": "UniProtKB", "id": "P07285", "url": "https://www.uniprot.org/uniprot/P07285" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 119, "end_pos": 121, "annotation": "n_glycosylation_sequon" }, { "start_pos": 165, "end_pos": 167, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11768", "name": "", "equation": "diphosphate + N-(5-phospho-beta-D-ribosyl)anthranilate = 5-phospho-alpha-D-ribose 1-diphosphate + anthranilate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07285-1" ], "evidence": [ { "id": "11768", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11768" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P07285", "gene_name": "TRP4", "activity": [ { "ec_number": "2.4.2.18", "activity": "diphosphate + N-(5-phospho-beta-D-ribosyl)anthranilate = 5-phospho-alpha-D-ribose 1-diphosphate + anthranilate.", "evidence": [ { "id": "P07285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07285" } ] }, { "ec_number": "2.4.2.18", "activity": "", "evidence": [ { "id": "P07285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07285" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }