{ "uniprot_canonical_ac": "P07146-1", "uniprot_ac": "P07146", "uniprot_id": "TRY2_MOUSE", "mass": { "chemical_mass": 26204.0, "monoisotopic_mass": 26204.0 }, "refseq": { "ac": "NP_033456", "name": "anionic trypsin-2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456" }, "gene_names": [ { "name": "Prss2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07146", "id": "P07146" }, { "name": "Prss2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456", "id": "NP_033456" }, { "name": "Ta; Tesp4; Try2; TRY8; TRYP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456", "id": "NP_033456" }, { "name": "Try2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07146", "id": "P07146" } ], "protein_names": [ { "name": "Anionic trypsin-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07146" }, { "name": "3.4.21.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07146" }, { "name": "Anionic trypsin II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07146" }, { "name": "Pretrypsinogen II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07146" }, { "name": "Serine protease 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07146" }, { "name": "anionic trypsin-2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456", "id": "NP_033456" }, { "name": "anionic trypsin-2; trypsinogen 20; pretrypsinogen II; anionic trypsin II; trypsin 2; protease, serine 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456", "id": "NP_033456" } ], "function": [ { "annotation": "PRSS2 overexpression relates to poor prognosis and promotes proliferation, migration and invasion in gastric cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_033456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456" }, { "database": "PubMed", "id": "36240716", "url": "https://glygen.org/publication/PubMed/36240716" } ] }, { "annotation": "Up-regulation of trypsins is one of the key host pathological findings in influenza A-induced myocarditis", "evidence": [ { "database": "RefSeq", "id": "NP_033456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456" }, { "database": "PubMed", "id": "21084314", "url": "https://glygen.org/publication/PubMed/21084314" } ] } ], "disease": [ { "disease_id": "DOID:1485", "recommended_name": { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "cystic fibrosis", "description": "A syndrome that is characterized by the buildup of thick, sticky mucus that can damage many organs." }, "synonyms": [ { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "CF", "description": "" }, { "id": "DOID:1485", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1485", "name": "mucoviscidosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis", "description": "Cystic fibrosis (CF) is a genetic disorder characterized by the production of sweat with a high salt content and mucus secretions with an abnormal viscosity." }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "CF", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "cystic fibrosis lung disease, modifier of", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "mucoviscidosis", "description": "" }, { "id": "MONDO:0009061", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009061", "name": "pseudomonas aeruginosa, susceptibility to chronic infection by, in cystic fibrosis", "description": "" }, { "id": "MIM:219700", "resource": "MIM", "url": "https://www.omim.org/entry/219700", "name": "Cystic fibrosis", "description": "Cystic fibrosis" } ], "evidence": [ { "id": "1485", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1485" } ] }, { "disease_id": "DOID:4947", "recommended_name": { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "cholangiocarcinoma", "description": "A bile duct adenocarcinoma that has_material_basis_in bile duct epithelial cells." }, "synonyms": [ { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "adult primary Cholangiocarcinoma", "description": "" }, { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "adult primary cholangiocellular carcinoma", "description": "" }, { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "cholangiosarcoma", "description": "" } ], "evidence": [ { "id": "4947", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4947" } ] }, { "disease_id": "DOID:4989", "recommended_name": { "id": "DOID:4989", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4989", "name": "pancreatitis", "description": "A pancreas disease that is characterized by inflammation of the pancreas." }, "synonyms": [ { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary chronic pancreatitis", "description": "Hereditary chronic pancreatitis (HCP), a rare inherited form of pancreatitis is defined as recurrent acute pancreatitis and/or chronic pancreatitis in two first-degree relatives or 3 or more second-degree relatives in 2 or more generations, for which no predisposing factors are identified. HCP is characterized by irreversible damage to both exocrine and endocrine components of the pancreas." }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary chronic pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "hereditary pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "HPC", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "Hp", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "PCTT", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "autosomal dominant hereditary pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "familial pancreatitis", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, calcific", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, calcific, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic pancreatitis, chronic, susceptibility to, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, protection against", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, protection against, included", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, chronic, susceptibility to", "description": "" }, { "id": "MONDO:0008185", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008185", "name": "pancreatitis, hereditary", "description": "" }, { "id": "MIM:167800", "resource": "MIM", "url": "https://www.omim.org/entry/167800", "name": "Pancreatitis, hereditary", "description": "Pancreatitis, hereditary" } ], "evidence": [ { "id": "4989", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4989" } ] }, { "disease_id": "DOID:9744", "recommended_name": { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "type 1 diabetes mellitus", "description": "A diabetes mellitus that is characterized by destruction of pancreatic beta cells resulting in absent or extremely low insulin production." }, "synonyms": [ { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "IDDM", "description": "" }, { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9744", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9744", "name": "type I diabetes mellitus", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type 1 diabetes mellitus", "description": "A chronic condition characterized by minimal or absent production of insulin by the pancreas." }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "IDDM", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "diabetes mellitis type 1", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "diabetes mellitis type I", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "immune mediated diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "juvenile diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type 1 diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type I diabetes", "description": "" }, { "id": "MONDO:0005147", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005147", "name": "type I diabetes mellitus", "description": "" }, { "id": "MIM:222100", "resource": "MIM", "url": "https://www.omim.org/entry/222100", "name": "Type 1 diabetes mellitus", "description": "Type 1 diabetes mellitus" } ], "evidence": [ { "id": "9744", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9744" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Prss2", "url": "https://www.uniprot.org/uniprot/P07146", "locus": { "chromosome": "6", "start_pos": 41502013, "end_pos": 41498721, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000057163", "url": "https://www.ensembl.org/id/ENSMUSG00000057163" } ] } } ], "crossref": [ { "id": "ENSMUSG00000057163", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000057163", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00190", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22072", "url": "https://www.ncbi.nlm.nih.gov/gene/22072", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001254", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001254", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22072", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22072", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "102759", "url": "http://www.informatics.jax.org/marker/MGI:102759", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "P07146", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07146", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "GCEYQRI", "url": "https://omabrowser.org/oma/group/GCEYQRI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4629979at2759", "url": "http://www.orthodb.org/?query=4629979at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24264", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24264", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24264:SF57", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24264:SF57", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00089", "url": "http://pfam.xfam.org/family/PF00089", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P07146", "url": "http://purl.obolibrary.org/obo/PR_P07146", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1442490", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1442490", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1592389", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1592389", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6803157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_033456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07146-1", "url": "https://www.uniprot.org/uniprot/P07146-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSALLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSLNAGYHFCGGSLINDQWVVSAAHCYKYRIQVRLGEHNINVLEGNEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTIADN", "length": 246, "header": "sp|P07146-1|TRY2_MOUSE Isoform 1 of Anionic trypsin-2 OS=Mus musculus OX=10090 GN=Prss2 PE=1 SV=1 CANONICAL=P07146-1" }, "isoforms": [ { "isoform_ac": "P07146-1", "url": "", "sequence": { "sequence": "MSALLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSLNAGYHFCGGSLINDQWVVSAAHCYKYRIQVRLGEHNINVLEGNEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTIADN", "length": 246, "header": "sp|P07146-1|TRY2_MOUSE Isoform 1 of Anionic trypsin-2 OS=Mus musculus OX=10090 GN=Prss2 PE=1 SV=1 CANONICAL=P07146-1" }, "locus": { "chromosome": "6", "start_pos": 41501953, "end_pos": 41498738, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000070380", "url": "https://www.ensembl.org/id/ENSMUST00000070380" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000065393", "url": "https://www.ensembl.org/id/ENSMUSP00000065393" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P07146", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07146" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A homologue of pancreatic trypsin is localized in the acrosome of mammalian sperm and is released during acrosome reaction.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Sato S., Yamagata K., Kobayashi Y., Baba T., Kashiwabara S., Kohno N., Ohmura K.", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "reference": [ { "type": "PubMed", "id": "10506205", "url": "https://glygen.org/publication/PubMed/10506205" } ] }, { "title": "Up-regulation of ectopic trypsins in the myocardium by influenza A virus infection triggers acute myocarditis.", "journal": "Cardiovascular research", "date": "2011", "authors": "Pan HY, Yamada H, Chida J, Wang S, Yano M, Yao M, Zhu J, Kido H", "evidence": [ { "database": "RefSeq", "id": "NP_033456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456" } ], "reference": [ { "type": "PubMed", "id": "21084314", "url": "https://glygen.org/publication/PubMed/21084314" } ] }, { "title": "PRSS2 overexpression relates to poor prognosis and promotes proliferation, migration and invasion in gastric cancer.", "journal": "Tissue & cell", "date": "2022-12", "authors": "Chen Yu, Wang Biling, Zhao Zihao, Li Ming, Wang Fei", "evidence": [ { "database": "RefSeq", "id": "NP_033456", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033456" } ], "reference": [ { "type": "PubMed", "id": "36240716", "url": "https://glygen.org/publication/PubMed/36240716" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07146", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07146" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] }, { "title": "Sequence organisation and transcriptional regulation of the mouse elastase II and trypsin genes.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Stevenson BJ, Hagenbuchle O, Wellauer PK", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "reference": [ { "type": "PubMed", "id": "3641189", "url": "https://glygen.org/publication/PubMed/3641189" } ] } ], "pathway": [ { "id": "mmu:22072", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22072", "resource": "KEGG Pathway" }, { "id": "R-MMU-1442490", "name": "Collagen degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1442490", "resource": "Reactome", "description": "Collagen degradation" }, { "id": "R-MMU-1462054", "name": "Alpha-defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "resource": "Reactome", "description": "Alpha-defensins" }, { "id": "R-MMU-1592389", "name": "Activation of Matrix Metalloproteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1592389", "resource": "Reactome", "description": "Activation of Matrix Metalloproteinases" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-MMU-6803157", "name": "Antimicrobial peptides", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6803157", "resource": "Reactome", "description": "Antimicrobial peptides" } ], "orthologs": [ { "uniprot_canonical_ac": "P00762-1", "protein_name": "Serine protease 1", "gene_name": "Prss1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSALLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN", "length": 246 }, "evidence": [ { "id": "45225312", "url": "http://www.informatics.jax.org/homology/45225312", "database": "MGI" }, { "id": "P07146", "url": "https://omabrowser.org/oma/group/P07146/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P07478-1", "protein_name": "Trypsin-2", "gene_name": "PRSS2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS", "length": 247 }, "evidence": [ { "id": "45225312", "url": "http://www.informatics.jax.org/homology/45225312", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "serine-type endopeptidase activity", "id": "GO:0004252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "response to nutrient", "id": "GO:0007584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007584", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "response to nicotine", "id": "GO:0035094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035094", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "response to caffeine", "id": "GO:0031000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031000", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "digestion", "id": "GO:0007586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007586", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" }, { "name": "collagen catabolic process", "id": "GO:0030574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030574", "evidence": [ { "database": "UniProtKB", "id": "P07146", "url": "https://www.uniprot.org/uniprot/P07146" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-1454822", "name": "Collagen type I degradation by MMP1,2,8,13, PRSS2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70138-1", "P33435-1", "P07146-1", "Q9R0T7-1", "P33434-1", "Q9EPL5-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-1454822", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1454822" } ] }, { "id": "R-MMU-1461993", "name": "pro-HD5 is cleaved by trypsin", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07146-1", "Q9R0T7-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-1461993", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1461993" } ] }, { "id": "R-MMU-1474197", "name": "Collagen type II degradation by MMP1,3,8,13,PRSS2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70138-1", "P33435-1", "P07146-1", "Q9R0T7-1", "P28862-1", "Q9EPL5-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-1474197", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1474197" } ] }, { "id": "R-MMU-1592316", "name": "Initial activation of proMMP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [ "R-MMU-1602455" ], "output_participant_list": [ "R-MMU-1602470", "R-MMU-1602471" ], "enzyme_list": [ "P07146-1", "Q9R0T7-1", "Q3UP87-1", "P26262-1", "P21845-1", "P28293-1", "P20918-1", "Q9EPL5-1", "P21844-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-1592316", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1592316" } ] }, { "id": "R-MMU-1604722", "name": "Activation of proMMP9 by proteases", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [ "R-MMU-1604713", "R-MMU-668812" ], "enzyme_list": [ "P07146-1", "Q9R0T7-1", "Q9CR35-1", "P28293-1", "P41245-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-1604722", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1604722" } ] }, { "id": "R-MMU-6798745", "name": "Exocytosis of tertiary granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, tertiary granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70138-1", "P07146-1", "Q9R0T7-1", "Q8VCF1-1", "Q9JHW2-1", "Q9D0F9-1", "P29351-1", "O70370-1", "Q9D7Q1-1", "P09528-1", "P08071-1", "P24527-1", "P56389-1", "P18242-1", "Q9Z0L8-1", "O88844-1", "P41245-1", "Q8BND5-1", "Q9CYK2-1", "P05063-1", "P05064-1", "Q9WV54-1", "P08905-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-6798745", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798745" } ] }, { "id": "R-MMU-6798751", "name": "Exocytosis of azurophil granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, azurophil granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q99KR8-1", "Q99LJ1-1", "Q61096-1", "P07146-1", "Q9R0T7-1", "Q3UP87-1", "Q9ET22-1", "P11247-1", "P50096-1", "P28867-1", "Q9DCN2-1", "O08709-1", "Q91V92-1", "P50429-1", "Q61176-1", "Q8BWM0-1", "Q8CI94-1", "Q01853-1", "Q62465-1", "P20060-1", "Q08642-1", "C0HKG6-1", "O35292-1", "Q91W90-1", "C0HKG5-1", "Q922K9-1", "P50428-1", "P12265-1", "P23780-1", "P28293-1", "P97821-1", "Q571E4-1", "Q9Z0L8-1", "P16675-1", "P63085-1", "Q8BFS6-1", "Q8CC86-1", "P51569-1", "Q64191-1", "P97425-1", "P97426-1", "Q8BFR4-1", "O09159-1", "P08905-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-6798751", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798751" } ] }, { "id": "R-MMU-6801766", "name": "Trypsin cleaves REG3A or REG3G to generate REG3A,G(38-175)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07146-1", "Q9R0T7-1", "Q9QUK9-1" ], "evidence": [ { "id": "R-MMU-6801766", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6801766" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-1602455", "participant_name": "MMP1(20-469) [extracellular region]", "crossref": [ { "id": "ENSMUST00000217651", "database": "Ensembl", "url": "" }, { "id": "1933846", "database": "MGI", "url": "" }, { "id": "Q9EPL5", "database": "PRO", "url": "" }, { "id": "Q9EPL5", "database": "UniProt", "url": "" }, { "id": "ENSMUSP00000151193", "database": "Ensembl", "url": "" }, { "id": "NP_114395.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000043089", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-1602470", "participant_name": "MMP1(54-469) [extracellular region]", "crossref": [ { "id": "Q9EPL5", "database": "UniProt", "url": "" }, { "id": "1933846", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000151193", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000217651", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000043089", "database": "Ensembl", "url": "" }, { "id": "Q9EPL5", "database": "PRO", "url": "" }, { "id": "NP_114395.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-1602471", "participant_name": "MMP1(20-53) [extracellular region]", "crossref": [ { "id": "Q9EPL5", "database": "UniProt", "url": "" }, { "id": "1933846", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000151193", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000217651", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000043089", "database": "Ensembl", "url": "" }, { "id": "Q9EPL5", "database": "PRO", "url": "" }, { "id": "NP_114395.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-1604713", "participant_name": "MMP9(20-106) [extracellular region]", "crossref": [ { "id": "P41245", "database": "UniProt", "url": "" }, { "id": "NP_038627.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000017881", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000017881", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000017737", "database": "Ensembl", "url": "" }, { "id": "MMP9_MOUSE", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "P41245", "database": "ZINC target", "url": "" }, { "id": "P41245", "database": "PRO", "url": "" }, { "id": "3.4.24.35", "database": "IntEnz", "url": "" }, { "id": "MMP9_MOUSE", "database": "ZINC - Substances", "url": "" }, { "id": "97011", "database": "MGI", "url": "" } ] }, { "participant_id": "R-MMU-668812", "participant_name": "MMP9(107-707) [extracellular region]", "crossref": [ { "id": "P41245", "database": "UniProt", "url": "" }, { "id": "NP_038627.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000017881", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000017881", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000017737", "database": "Ensembl", "url": "" }, { "id": "MMP9_MOUSE", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "P41245", "database": "ZINC target", "url": "" }, { "id": "P41245", "database": "PRO", "url": "" }, { "id": "3.4.24.35", "database": "IntEnz", "url": "" }, { "id": "MMP9_MOUSE", "database": "ZINC - Substances", "url": "" }, { "id": "97011", "database": "MGI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "C0HKG5", "gene_name": "Rnaset2a", "activity": [ { "ec_number": "4.6.1.19", "activity": "a ribonucleotidyl-ribonucleotide-RNA + H2O = a 3'-end 3'-phospho-ribonucleotide-RNA + a 5'-end dephospho-ribonucleoside-RNA + H(+).", "evidence": [ { "id": "C0HKG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKG5" } ] }, { "ec_number": "4.6.1.19", "activity": "", "evidence": [ { "id": "C0HKG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKG5" } ] } ] }, { "uniprot_ac": "C0HKG6", "gene_name": "Rnaset2b", "activity": [ { "ec_number": "4.6.1.19", "activity": "a ribonucleotidyl-ribonucleotide-RNA + H2O = a 3'-end 3'-phospho-ribonucleotide-RNA + a 5'-end dephospho-ribonucleoside-RNA + H(+).", "evidence": [ { "id": "C0HKG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKG6" } ] }, { "ec_number": "4.6.1.19", "activity": "", "evidence": [ { "id": "C0HKG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C0HKG6" } ] } ] }, { "uniprot_ac": "O08709", "gene_name": "Prdx6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] } ] }, { "uniprot_ac": "O09159", "gene_name": "Man2b1", "activity": [ { "ec_number": "3.2.1.24", "activity": "Hydrolysis of terminal, non-reducing alpha-D-mannose residues in alpha-D-mannosides.", "evidence": [ { "id": "O09159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09159" } ] }, { "ec_number": "3.2.1.24", "activity": "", "evidence": [ { "id": "O09159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09159" } ] } ] }, { "uniprot_ac": "O35292", "gene_name": "Rnase2b", "activity": [ { "ec_number": "4.6.1.18", "activity": "an [RNA] containing cytidine + H2O = an [RNA]-3'-cytidine-3'-phosphate + a 5'-hydroxy-ribonucleotide-3'-[RNA].", "evidence": [ { "id": "O35292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35292" } ] }, { "ec_number": "4.6.1.18", "activity": "", "evidence": [ { "id": "O35292", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35292" } ] } ] }, { "uniprot_ac": "O70138", "gene_name": "Mmp8", "activity": [ { "ec_number": "3.4.24.34", "activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.", "evidence": [ { "id": "O70138", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70138" } ] }, { "ec_number": "3.4.24.34", "activity": "", "evidence": [ { "id": "O70138", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70138" } ] } ] }, { "uniprot_ac": "O70370", "gene_name": "Ctss", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "O70370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70370" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "O70370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70370" } ] } ] }, { "uniprot_ac": "O88844", "gene_name": "Idh1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O88844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88844" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O88844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88844" } ] } ] }, { "uniprot_ac": "P05063", "gene_name": "Aldoc", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05063" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05063" } ] } ] }, { "uniprot_ac": "P05064", "gene_name": "Aldoa", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05064" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05064" } ] } ] }, { "uniprot_ac": "P07146", "gene_name": "Prss2", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "P07146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07146" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "P07146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07146" } ] } ] }, { "uniprot_ac": "P08071", "gene_name": "Ltf", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "P08071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08071" } ] } ] }, { "uniprot_ac": "P08905", "gene_name": "Lyz2", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P08905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08905" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P08905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08905" } ] } ] }, { "uniprot_ac": "P09528", "gene_name": "Fth1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P09528", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09528" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P09528", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09528" } ] } ] }, { "uniprot_ac": "P11247", "gene_name": "Mpo", "activity": [ { "ec_number": "1.11.2.2", "activity": "chloride + H(+) + H2O2 = H2O + hypochlorous acid.", "evidence": [ { "id": "P11247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11247" } ] }, { "ec_number": "1.11.2.2", "activity": "", "evidence": [ { "id": "P11247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11247" } ] } ] }, { "uniprot_ac": "P12265", "gene_name": "Gusb", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P12265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12265" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P12265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12265" } ] } ] }, { "uniprot_ac": "P16675", "gene_name": "Ctsa", "activity": [ { "ec_number": "3.4.16.5", "activity": "Release of a C-terminal amino acid with broad specificity.", "evidence": [ { "id": "P16675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16675" } ] }, { "ec_number": "3.4.16.5", "activity": "", "evidence": [ { "id": "P16675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16675" } ] }, { "ec_number": "3.4.16.-", "activity": "", "evidence": [ { "id": "P16675", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16675" } ] } ] }, { "uniprot_ac": "P18242", "gene_name": "Ctsd", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P18242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18242" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P18242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18242" } ] } ] }, { "uniprot_ac": "P20060", "gene_name": "Hexb", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "P20060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20060" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "P20060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20060" } ] } ] }, { "uniprot_ac": "P20918", "gene_name": "Plg", "activity": [ { "ec_number": "3.4.21.7", "activity": "Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.", "evidence": [ { "id": "P20918", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20918" } ] }, { "ec_number": "3.4.21.7", "activity": "", "evidence": [ { "id": "P20918", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20918" } ] } ] }, { "uniprot_ac": "P21844", "gene_name": "Cma1", "activity": [ { "ec_number": "3.4.21.39", "activity": "Preferential cleavage: Phe-|-Xaa > Tyr-|-Xaa > Trp-|-Xaa > Leu-|-Xaa.", "evidence": [ { "id": "P21844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21844" } ] }, { "ec_number": "3.4.21.39", "activity": "", "evidence": [ { "id": "P21844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21844" } ] } ] }, { "uniprot_ac": "P21845", "gene_name": "Tpsb2", "activity": [ { "ec_number": "3.4.21.59", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa, but with more restricted specificity than trypsin.", "evidence": [ { "id": "P21845", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21845" } ] }, { "ec_number": "3.4.21.59", "activity": "", "evidence": [ { "id": "P21845", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21845" } ] } ] }, { "uniprot_ac": "P23780", "gene_name": "Glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "P23780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23780" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "P23780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23780" } ] } ] }, { "uniprot_ac": "P24527", "gene_name": "Lta4h", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] } ] }, { "uniprot_ac": "P26262", "gene_name": "Klkb1", "activity": [ { "ec_number": "3.4.21.34", "activity": "Cleaves selectively Arg-|-Xaa and Lys-|-Xaa bonds, including Lys-|-Arg and Arg-|-Ser bonds in (human) kininogen to release bradykinin.", "evidence": [ { "id": "P26262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26262" } ] }, { "ec_number": "3.4.21.34", "activity": "", "evidence": [ { "id": "P26262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26262" } ] } ] }, { "uniprot_ac": "P28293", "gene_name": "Ctsg", "activity": [ { "ec_number": "3.4.21.20", "activity": "Specificity similar to chymotrypsin C.", "evidence": [ { "id": "P28293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28293" } ] }, { "ec_number": "3.4.21.20", "activity": "", "evidence": [ { "id": "P28293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28293" } ] } ] }, { "uniprot_ac": "P28862", "gene_name": "Mmp3", "activity": [ { "ec_number": "3.4.24.17", "activity": "Preferential cleavage where P1', P2' and P3' are hydrophobic residues.", "evidence": [ { "id": "P28862", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28862" } ] }, { "ec_number": "3.4.24.17", "activity": "", "evidence": [ { "id": "P28862", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28862" } ] } ] }, { "uniprot_ac": "P28867", "gene_name": "Prkcd", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] }, { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P28867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28867" } ] } ] }, { "uniprot_ac": "P29351", "gene_name": "Ptpn6", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P29351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29351" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29351" } ] } ] }, { "uniprot_ac": "P33434", "gene_name": "Mmp2", "activity": [ { "ec_number": "3.4.24.24", "activity": "Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.", "evidence": [ { "id": "P33434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33434" } ] }, { "ec_number": "3.4.24.24", "activity": "", "evidence": [ { "id": "P33434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33434" } ] } ] }, { "uniprot_ac": "P33435", "gene_name": "Mmp13", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "P33435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33435" } ] } ] }, { "uniprot_ac": "P41245", "gene_name": "Mmp9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P41245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41245" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P41245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41245" } ] } ] }, { "uniprot_ac": "P50096", "gene_name": "Impdh1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P50096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50096" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P50096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50096" } ] } ] }, { "uniprot_ac": "P50428", "gene_name": "Arsa", "activity": [ { "ec_number": "3.1.6.8", "activity": "H2O + N-acyl-1-beta-D-(3-O-sulfo)-galactosyl-sphing-4-enine = a beta-D-galactosyl-(1<->1')-N-acylsphing-4-enine + H(+) + sulfate.", "evidence": [ { "id": "P50428", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50428" } ] }, { "ec_number": "3.1.6.8", "activity": "", "evidence": [ { "id": "P50428", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50428" } ] } ] }, { "uniprot_ac": "P50429", "gene_name": "Arsb", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P50429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50429" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P50429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50429" } ] } ] }, { "uniprot_ac": "P51569", "gene_name": "Gla", "activity": [ { "ec_number": "3.2.1.-", "activity": "", "evidence": [ { "id": "P51569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51569" } ] }, { "ec_number": "3.2.1.22", "activity": "globoside Gb3Cer (d18:1(4E)) + H2O = a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + D-galactose.", "evidence": [ { "id": "P51569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51569" } ] }, { "ec_number": "3.2.1.22", "activity": "", "evidence": [ { "id": "P51569", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51569" } ] } ] }, { "uniprot_ac": "P56389", "gene_name": "Cda", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "P56389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56389" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "P56389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56389" } ] } ] }, { "uniprot_ac": "P63085", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] } ] }, { "uniprot_ac": "P97425", "gene_name": "Ear2", "activity": [ { "ec_number": "3.1.27.-", "activity": "", "evidence": [ { "id": "P97425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97425" } ] } ] }, { "uniprot_ac": "P97426", "gene_name": "Ear1", "activity": [ { "ec_number": "3.1.27.-", "activity": "", "evidence": [ { "id": "P97426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97426" } ] } ] }, { "uniprot_ac": "P97821", "gene_name": "Ctsc", "activity": [ { "ec_number": "3.4.14.1", "activity": "Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, except when Xaa is Arg or Lys, or Yaa or Zaa is Pro.", "evidence": [ { "id": "P97821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97821" } ] }, { "ec_number": "3.4.14.1", "activity": "", "evidence": [ { "id": "P97821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97821" } ] } ] }, { "uniprot_ac": "Q01853", "gene_name": "Vcp", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q01853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01853" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "Q01853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01853" } ] } ] }, { "uniprot_ac": "Q08642", "gene_name": "Padi2", "activity": [ { "ec_number": "3.5.3.15", "activity": "H2O + L-arginyl-[protein] = L-citrullyl-[protein] + NH4(+).", "evidence": [ { "id": "Q08642", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08642" } ] }, { "ec_number": "3.5.3.15", "activity": "", "evidence": [ { "id": "Q08642", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08642" } ] } ] }, { "uniprot_ac": "Q3UP87", "gene_name": "Elane", "activity": [ { "ec_number": "3.4.21.37", "activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.", "evidence": [ { "id": "Q3UP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP87" } ] }, { "ec_number": "3.4.21.37", "activity": "", "evidence": [ { "id": "Q3UP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP87" } ] } ] }, { "uniprot_ac": "Q571E4", "gene_name": "Galns", "activity": [ { "ec_number": "3.1.6.4", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-galactosamine 6-sulfate units of chondroitin sulfate and of the D-galactose 6-sulfate units of keratan sulfate.", "evidence": [ { "id": "Q571E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q571E4" } ] }, { "ec_number": "3.1.6.4", "activity": "", "evidence": [ { "id": "Q571E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q571E4" } ] } ] }, { "uniprot_ac": "Q61096", "gene_name": "Prtn3", "activity": [ { "ec_number": "3.4.21.76", "activity": "Hydrolysis of proteins, including elastin, by preferential cleavage: -Ala-|-Xaa- > -Val-|-Xaa-.", "evidence": [ { "id": "Q61096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61096" } ] }, { "ec_number": "3.4.21.76", "activity": "", "evidence": [ { "id": "Q61096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61096" } ] } ] }, { "uniprot_ac": "Q61176", "gene_name": "Arg1", "activity": [ { "ec_number": "3.5.3.1", "activity": "H2O + L-arginine = L-ornithine + urea.", "evidence": [ { "id": "Q61176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61176" } ] }, { "ec_number": "3.5.3.1", "activity": "", "evidence": [ { "id": "Q61176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61176" } ] } ] }, { "uniprot_ac": "Q62465", "gene_name": "Vat1", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q62465", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62465" } ] } ] }, { "uniprot_ac": "Q64191", "gene_name": "Aga", "activity": [ { "ec_number": "3.5.1.26", "activity": "H2O + N(4)-(beta-N-acetyl-D-glucosaminyl)-L-asparagine = H(+) + L-aspartate + N-acetyl-beta-D-glucosaminylamine.", "evidence": [ { "id": "Q64191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64191" } ] }, { "ec_number": "3.5.1.26", "activity": "", "evidence": [ { "id": "Q64191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64191" } ] } ] }, { "uniprot_ac": "Q8BFR4", "gene_name": "Gns", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "Q8BFR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFR4" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "Q8BFR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFR4" } ] } ] }, { "uniprot_ac": "Q8BFS6", "gene_name": "Cpped1", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "Q8BFS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFS6" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8BFS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFS6" } ] } ] }, { "uniprot_ac": "Q8BND5", "gene_name": "Qsox1", "activity": [ { "ec_number": "1.8.3.2", "activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.", "evidence": [ { "id": "Q8BND5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BND5" } ] }, { "ec_number": "1.8.3.2", "activity": "", "evidence": [ { "id": "Q8BND5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BND5" } ] } ] }, { "uniprot_ac": "Q8BWM0", "gene_name": "Ptges2", "activity": [ { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "Q8BWM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWM0" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q8BWM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWM0" } ] } ] }, { "uniprot_ac": "Q8CC86", "gene_name": "Naprt", "activity": [ { "ec_number": "6.3.4.21", "activity": "5-phospho-alpha-D-ribose 1-diphosphate + ATP + H2O + nicotinate = ADP + diphosphate + nicotinate beta-D-ribonucleotide + phosphate.", "evidence": [ { "id": "Q8CC86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CC86" } ] }, { "ec_number": "6.3.4.21", "activity": "", "evidence": [ { "id": "Q8CC86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CC86" } ] } ] }, { "uniprot_ac": "Q8CI94", "gene_name": "Pygb", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "Q8CI94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CI94" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "Q8CI94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CI94" } ] } ] }, { "uniprot_ac": "Q8VCF1", "gene_name": "Cant1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8VCF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCF1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8VCF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCF1" } ] } ] }, { "uniprot_ac": "Q91V92", "gene_name": "Acly", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "Q91V92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V92" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "Q91V92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V92" } ] } ] }, { "uniprot_ac": "Q91W90", "gene_name": "Txndc5", "activity": [ { "ec_number": "5.3.4.1", "activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.", "evidence": [ { "id": "Q91W90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91W90" } ] }, { "ec_number": "5.3.4.1", "activity": "", "evidence": [ { "id": "Q91W90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91W90" } ] }, { "ec_number": "1.8.4.-", "activity": "", "evidence": [ { "id": "Q91W90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91W90" } ] } ] }, { "uniprot_ac": "Q922K9", "gene_name": "Frk", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q922K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922K9" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "Q922K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922K9" } ] } ] }, { "uniprot_ac": "Q99KR8", "gene_name": "Fuca2", "activity": [ { "ec_number": "3.2.1.51", "activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.", "evidence": [ { "id": "Q99KR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KR8" } ] }, { "ec_number": "3.2.1.51", "activity": "", "evidence": [ { "id": "Q99KR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KR8" } ] } ] }, { "uniprot_ac": "Q99LJ1", "gene_name": "Fuca1", "activity": [ { "ec_number": "3.2.1.51", "activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.", "evidence": [ { "id": "Q99LJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LJ1" } ] }, { "ec_number": "3.2.1.51", "activity": "", "evidence": [ { "id": "Q99LJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LJ1" } ] } ] }, { "uniprot_ac": "Q9CR35", "gene_name": "Ctrb1", "activity": [ { "ec_number": "3.4.21.1", "activity": "Preferential cleavage: Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa.", "evidence": [ { "id": "Q9CR35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR35" } ] }, { "ec_number": "3.4.21.1", "activity": "", "evidence": [ { "id": "Q9CR35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR35" } ] } ] }, { "uniprot_ac": "Q9CYK2", "gene_name": "Qpct", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q9CYK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CYK2" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q9CYK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CYK2" } ] } ] }, { "uniprot_ac": "Q9D0F9", "gene_name": "Pgm1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q9D0F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0F9" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "Q9D0F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0F9" } ] } ] }, { "uniprot_ac": "Q9D7Q1", "gene_name": "Chit1", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "Q9D7Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7Q1" } ] }, { "ec_number": "3.2.1.14", "activity": "", "evidence": [ { "id": "Q9D7Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7Q1" } ] } ] }, { "uniprot_ac": "Q9DCN2", "gene_name": "Cyb5r3", "activity": [ { "ec_number": "1.6.2.2", "activity": "2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+).", "evidence": [ { "id": "Q9DCN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCN2" } ] }, { "ec_number": "1.6.2.2", "activity": "", "evidence": [ { "id": "Q9DCN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCN2" } ] } ] }, { "uniprot_ac": "Q9EPL5", "gene_name": "Mmp1a", "activity": [ { "ec_number": "3.4.24.7", "activity": "Cleavage of the triple helix of collagen at about three-quarters of the length of the molecule from the N-terminus, at 775-Gly-|-Ile-776 in the alpha1(I) chain. Cleaves synthetic substrates and alpha-macroglobulins at bonds where P1' is a hydrophobic residue.", "evidence": [ { "id": "Q9EPL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPL5" } ] }, { "ec_number": "3.4.24.7", "activity": "", "evidence": [ { "id": "Q9EPL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPL5" } ] } ] }, { "uniprot_ac": "Q9ET22", "gene_name": "Dpp7", "activity": [ { "ec_number": "3.4.14.2", "activity": "Release of an N-terminal dipeptide, Xaa-Yaa-|-, preferentially when Yaa is Ala or Pro. Substrates are oligopeptides, preferentially tripeptides.", "evidence": [ { "id": "Q9ET22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET22" } ] }, { "ec_number": "3.4.14.2", "activity": "", "evidence": [ { "id": "Q9ET22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET22" } ] } ] }, { "uniprot_ac": "Q9JHW2", "gene_name": "Nit2", "activity": [ { "ec_number": "3.5.1.3", "activity": "a monoamide of a dicarboxylate + H2O = a dicarboxylate + NH4(+).", "evidence": [ { "id": "Q9JHW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW2" } ] }, { "ec_number": "3.5.1.3", "activity": "", "evidence": [ { "id": "Q9JHW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHW2" } ] } ] }, { "uniprot_ac": "Q9QUK9", "gene_name": "Try5", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "Q9QUK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUK9" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "Q9QUK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUK9" } ] } ] }, { "uniprot_ac": "Q9R0T7", "gene_name": "Try4", "activity": [ { "ec_number": "3.4.21.4", "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.", "evidence": [ { "id": "Q9R0T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0T7" } ] }, { "ec_number": "3.4.21.4", "activity": "", "evidence": [ { "id": "Q9R0T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0T7" } ] } ] }, { "uniprot_ac": "Q9WV54", "gene_name": "Asah1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] } ] }, { "uniprot_ac": "Q9Z0L8", "gene_name": "Ggh", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q9Z0L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0L8" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q9Z0L8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0L8" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }