{
    "uniprot_canonical_ac": "P06320-1",
    "uniprot_ac": "P06320",
    "uniprot_id": "TVB7_MOUSE",
    "mass": {
        "chemical_mass": 14946.0,
        "monoisotopic_mass": 14946.0
    },
    "refseq": {},
    "gene_names": [],
    "protein_names": [
        {
            "name": "T-cell receptor beta chain V region CTL-F3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P06320"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P06320",
                    "url": "https://www.uniprot.org/uniprot/P06320"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/P06320",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "cd05899",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05899",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P06320",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P06320*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR003599",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007110",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013106",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013783",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036179",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23268",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23268:SF14",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF14",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF07686",
            "url": "http://pfam.xfam.org/family/PF07686",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P06320",
            "url": "https://www.uniprot.org/uniprot/P06320",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P06320-1",
            "url": "https://www.uniprot.org/uniprot/P06320-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAPRLLFCLVLCFLRAEPTNAGVIQTPRHKVTGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQSHSTLKIQSTQPQDSAVYLCASSLSTGVSYEQYFGPGTRLTVL",
        "length": 134,
        "header": "sp|P06320-1|TVB7_MOUSE Isoform 1 of T-cell receptor beta chain V region CTL-F3  OS=Mus musculus OX=10090 GN= PE=4 SV=1 CANONICAL=P06320-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P06320-1",
            "url": "",
            "sequence": {
                "sequence": "MAPRLLFCLVLCFLRAEPTNAGVIQTPRHKVTGKGQEATLWCEPISGHSAVFWYRQTIVQGLEFLTYFRNQAPIDDSGMPKERFSAQMPNQSHSTLKIQSTQPQDSAVYLCASSLSTGVSYEQYFGPGTRLTVL",
                "length": 134,
                "header": "sp|P06320-1|TVB7_MOUSE Isoform 1 of T-cell receptor beta chain V region CTL-F3  OS=Mus musculus OX=10090 GN= PE=4 SV=1 CANONICAL=P06320-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 90,
            "start_aa": "Asn",
            "end_pos": 90,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn90",
            "evidence": [
                {
                    "id": "P06320",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P06320#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "T cell receptor genes in an alloreactive CTL clone: implications for rearrangement and germline diversity of variable gene segments.",
            "journal": "EMBO J.",
            "date": "1986",
            "authors": "Russell J.H., Chou H.S., Behlke M.A., Loh D.Y., Brooks C.G., Godambe S.A.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P06320",
                    "url": "https://www.uniprot.org/uniprot/P06320"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3490968",
                    "url": "https://glygen.org/publication/PubMed/3490968"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P06320",
                                "url": "https://www.uniprot.org/uniprot/P06320"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "T cell receptor complex",
                        "id": "GO:0042101",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P06320",
                                "url": "https://www.uniprot.org/uniprot/P06320"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "cell surface receptor signaling pathway",
                        "id": "GO:0007166",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P06320",
                                "url": "https://www.uniprot.org/uniprot/P06320"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "adaptive immune response",
                        "id": "GO:0002250",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P06320",
                                "url": "https://www.uniprot.org/uniprot/P06320"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 90,
            "end_pos": 92,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}