{ "uniprot_canonical_ac": "P06106-1", "uniprot_ac": "P06106", "uniprot_id": "CYSD_YEAST", "mass": { "chemical_mass": 48672.0, "monoisotopic_mass": 48672.0 }, "refseq": { "ac": "NP_013406", "name": "bifunctional cysteine synthase/O-acetylhomoserine aminocarboxypropyltransferase MET17", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013406" }, "gene_names": [ { "name": "MET17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06106", "id": "P06106" }, { "name": "L8003.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06106", "id": "P06106" }, { "name": "MET15; MET25", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013406", "id": "NP_013406" }, { "name": "MET15", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06106", "id": "P06106" }, { "name": "MET17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013406", "id": "NP_013406" }, { "name": "MET25", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06106", "id": "P06106" } ], "protein_names": [ { "name": "Homocysteine/cysteine synthase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06106" }, { "name": "2.5.1.47", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06106" }, { "name": "2.5.1.49", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06106" }, { "name": "O-acetylserine/O-acetylhomoserine sulfhydrylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06106" }, { "name": "OAS-OAH SHLase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06106" }, { "name": "OAS-OAH sulfhydrylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06106" }, { "name": "bifunctional cysteine synthase/O-acetylhomoserine aminocarboxypropyltransferase MET17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013406", "id": "NP_013406" } ], "function": [ { "annotation": "Catalyzes the conversion of O-acetyl-L-homoserine (OAH) into homocysteine in the methionine biosynthesis pathway (PubMed:7765825, PubMed:4609980, PubMed:795806, PubMed:36455053, PubMed:36379252). Required to efficiently reduce toxic levels of hydrogen sulfide generated when the sulfate assimilation pathway (SAP) is active (PubMed:36455053, PubMed:36379252). Also catalyzes the conversion of O-acetylserine (OAS) into cysteine, the last step in the cysteine biosynthesis pathway (PubMed:7765825, PubMed:4609980, PubMed:795806, PubMed:36455053). However, it seems that in S.cerevisiae cysteine biosynthesis occurs exclusively through the cystathionine pathway and not via direct incorporation of sulfur into OAS (PubMed:1732168). It therefore has no metabolic role in cysteine biosynthesis and may only have a regulatory role controlling OAS levels (PubMed:12586406).", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106#function" }, { "database": "PubMed", "id": "795806", "url": "https://glygen.org/publication/PubMed/795806" }, { "database": "PubMed", "id": "4609980", "url": "https://glygen.org/publication/PubMed/4609980" }, { "database": "PubMed", "id": "36379252", "url": "https://glygen.org/publication/PubMed/36379252" }, { "database": "PubMed", "id": "1732168", "url": "https://glygen.org/publication/PubMed/1732168" }, { "database": "PubMed", "id": "36455053", "url": "https://glygen.org/publication/PubMed/36455053" }, { "database": "PubMed", "id": "12586406", "url": "https://glygen.org/publication/PubMed/12586406" }, { "database": "PubMed", "id": "7765825", "url": "https://glygen.org/publication/PubMed/7765825" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "common_name": "Yeast" } ], "gene": [ { "name": "MET17", "url": "https://www.uniprot.org/uniprot/P06106", "locus": { "chromosome": "XII", "start_pos": 733876, "end_pos": 732542, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YLR303W", "url": "https://www.ensembl.org/id/YLR303W" } ] } } ], "crossref": [ { "id": "cd00614", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00614", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "851010", "url": "https://www.ncbi.nlm.nih.gov/gene/851010", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P06106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06106*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000277", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000277", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015421", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015421", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015422", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015422", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR303W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR303W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TYTLFAH", "url": "https://omabrowser.org/oma/group/TYTLFAH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "6018at2759", "url": "http://www.orthodb.org/?query=6018at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43797", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43797", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43797:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43797:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01053", "url": "http://pfam.xfam.org/family/PF01053", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P06106", "url": "http://purl.obolibrary.org/obo/PR_P06106", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013406", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004294", "url": "https://www.yeastgenome.org/locus/S000004294", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06106-1", "url": "https://www.uniprot.org/uniprot/P06106-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAGQKP", "length": 444, "header": "sp|P06106-1|CYSD_YEAST Isoform 1 of Homocysteine/cysteine synthase OS=Saccharomyces cerevisiae S288C OX=559292 GN=MET17 PE=1 SV=3 CANONICAL=P06106-1" }, "isoforms": [ { "isoform_ac": "P06106-1", "url": "", "sequence": { "sequence": "MPSHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETVFAGQKP", "length": 444, "header": "sp|P06106-1|CYSD_YEAST Isoform 1 of Homocysteine/cysteine synthase OS=Saccharomyces cerevisiae S288C OX=559292 GN=MET17 PE=1 SV=3 CANONICAL=P06106-1" }, "locus": { "chromosome": "XII", "start_pos": 733873, "end_pos": 732542, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR303W_mRNA", "url": "https://www.ensembl.org/id/YLR303W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR303W", "url": "https://www.ensembl.org/id/YLR303W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P06106", "url": "https://www.yeastgenome.org/locus/P06106" } ], "site_lbl": "Ser34" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P06106", "url": "https://www.yeastgenome.org/locus/P06106" } ], "site_lbl": "Tyr35" }, { "start_pos": 377, "end_pos": 377, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P06106", "url": "https://www.yeastgenome.org/locus/P06106" } ], "site_lbl": "Ser377" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" }, { "database": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" }, { "database": "SGD", "id": "P06106", "url": "https://www.yeastgenome.org/locus/P06106" } ], "site_lbl": "Ser44" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "SGD", "id": "P06106", "url": "https://www.yeastgenome.org/locus/P06106" } ], "site_lbl": "Thr63" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Subcellular localization of the yeast proteome.", "journal": "Genes Dev.", "date": "2002", "authors": "Kumar A., Liu Y., Snyder M., Miller P., Agarwal S., Cheung K.-H., Jansen R., Heidtman M., Gerstein M., Roeder G.S., Drawid A., Heyman J.A., Matson S., Piccirillo S., Umansky L.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "11914276", "url": "https://glygen.org/publication/PubMed/11914276" } ] }, { "title": "Role of Saccharomyces cerevisiae serine O-acetyltransferase in cysteine biosynthesis.", "journal": "FEMS Microbiol. Lett.", "date": "2003", "authors": "Yoshioka K., Takagi H., Nakamori S., Ono B., Awano N.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "12586406", "url": "https://glygen.org/publication/PubMed/12586406" } ] }, { "title": "Genetic analysis of a new mutation conferring cysteine auxotrophy in Saccharomyces cerevisiae: updating of the sulfur metabolism pathway.", "journal": "Genetics", "date": "1992", "authors": "Cherest H., Surdin-Kerjan Y.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "1732168", "url": "https://glygen.org/publication/PubMed/1732168" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2007-03", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" }, { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-06-19", "authors": "Smolka Marcus B, Albuquerque Claudio P, Chen Sheng-hong, Zhou Huilin", "evidence": [ { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" } ], "reference": [ { "type": "PubMed", "id": "17563356", "url": "https://glygen.org/publication/PubMed/17563356" } ] }, { "title": "Role of hydrosulfide ions (HS-) in methylmercury resistance in Saccharomyces cerevisiae.", "journal": "Appl. Environ. Microbiol.", "date": "1991", "authors": "Ishii N., Fujino S., Ono B., Aoyama I.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "1781681", "url": "https://glygen.org/publication/PubMed/1781681" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008-07", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" }, { "database": "iPTMnet", "id": "P06106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06106" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "Nucleotide sequence of the Saccharomyces cerevisiae MET25 gene.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Kerjan P., Cherest H., Surdin-Kerjan Y.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "3022238", "url": "https://glygen.org/publication/PubMed/3022238" } ] }, { "title": "Molecular genetics of met17 and met25 mutants of Saccharomyces cerevisiae: intragenic complementation between mutations of a single structural gene.", "journal": "Mol. Gen. Genet.", "date": "1987", "authors": "D'Andrea R., Cherest H., Surdin-Kerjan Y., Pure G.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "3299001", "url": "https://glygen.org/publication/PubMed/3299001" } ] }, { "title": "On the illusion of auxotrophy: met15Delta yeast cells can grow on inorganic sulfur thanks to the previously uncharacterized homocysteine synthase Yll058w.", "journal": "J. Biol. Chem.", "date": "2022", "authors": "Van Oss S Branden, Parikh Saurin Bipin, Castilho Coelho Nelson, Wacholder Aaron, Belashov Ivan, Zdancewicz Sara, Michaca Manuel, Xu Jiazhen, Kang Yun Pyo, Ward Nathan P, Yoon Sang Jun, McCourt Katherine M, McKee Jake, Ideker Trey, VanDemark Andrew P, DeNicola Gina M, Carvunis Anne-Ruxandra", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "36379252", "url": "https://glygen.org/publication/PubMed/36379252" } ] }, { "title": "Inorganic sulfur fixation via a new homocysteine synthase allows yeast cells to cooperatively compensate for methionine auxotrophy.", "journal": "PLoS Biol.", "date": "2022", "authors": "Lee C.T., Lehmann A., Ralser M., Muelleder M., Agostini F., Aulakh S.K., Correia-Melo C., Demichev V., Hartl J., Heineike B.M., Lemke O., Messner C.B., Yu J.S.L.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "36455053", "url": "https://glygen.org/publication/PubMed/36455053" } ] }, { "title": "Evidence for the identity of O-acetylserine sulfhydrylase with O-acetylhomoserine sulfhydrylase in yeast.", "journal": "J. Biochem.", "date": "1974", "authors": "Naiki N., Yamagata S., Takeshima K.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "4609980", "url": "https://glygen.org/publication/PubMed/4609980" } ] }, { "title": "Homocysteine synthesis in yeast. Partial purification and properties of O-acetylhomoserine sulfhydrylase.", "journal": "J. Biochem.", "date": "1971", "authors": "Yamagata S.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "4947307", "url": "https://glygen.org/publication/PubMed/4947307" } ] }, { "title": "Overexpression of the Saccharomyces cerevisiae MET17/MET25 gene in Escherichia coli and comparative characterization of the product with O-acetylserine.O-acetylhomoserine sulfhydrylase of the yeast.", "journal": "Appl. Microbiol. Biotechnol.", "date": "1994", "authors": "Nakamura K., Doi K., D'Andrea R., Isaji M., Yamagata S., Fujisaki S., Bawden S.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "7765825", "url": "https://glygen.org/publication/PubMed/7765825" } ] }, { "title": "O-acetylserine and O-acetylhomoserine sulfhydrylase of yeast. Further purification and characterization as a pyridoxal enzyme.", "journal": "J. Biochem.", "date": "1976", "authors": "Yamagata S., Takeshima K.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "795806", "url": "https://glygen.org/publication/PubMed/795806" } ] }, { "title": "O-acetylserine and O-acetylhomoserine sulfhydrylase of yeast. Subunit structure.", "journal": "J. Biochem.", "date": "1976", "authors": "Yamagata S.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "795807", "url": "https://glygen.org/publication/PubMed/795807" } ] }, { "title": "Cystathionine gamma-lyase of Saccharomyces cerevisiae: structural gene and cystathionine gamma-synthase activity.", "journal": "Yeast", "date": "1993", "authors": "Yamamoto S., Ishii N., Ohmori S., Naito K., Miyoshi S., Shinoda S., Ono B.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "8511969", "url": "https://glygen.org/publication/PubMed/8511969" } ] }, { "title": "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae.", "journal": "FEMS Microbiol. Lett.", "date": "1996", "authors": "Blomberg A., Norbeck J.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "8935650", "url": "https://glygen.org/publication/PubMed/8935650" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] } ], "pathway": [ { "id": "sce:YLR303W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR303W", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "pyridoxal phosphate binding", "id": "GO:0030170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030170", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "cysteine synthase activity", "id": "GO:0004124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004124", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "O-acetylhomoserine aminocarboxypropyltransferase activity", "id": "GO:0003961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003961", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "O-acetylhomoserine sulfhydrylase activity", "id": "GO:0051009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051009", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "methionine metabolic process", "id": "GO:0006555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006555", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "transsulfuration", "id": "GO:0019346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019346", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" }, { "name": "cysteine biosynthetic process", "id": "GO:0019344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019344", "evidence": [ { "database": "UniProtKB", "id": "P06106", "url": "https://www.uniprot.org/uniprot/P06106" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10048", "name": "", "equation": "methanethiol + O-acetyl-L-homoserine = acetate + H(+) + L-methionine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06106-1", "Q12198-1" ], "evidence": [ { "id": "10048", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10048" } ] }, { "id": "14829", "name": "", "equation": "hydrogen sulfide + O-acetyl-L-serine = acetate + L-cysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06106-1", "Q12198-1", "P53206-1", "Q54CN7-1" ], "evidence": [ { "id": "14829", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14829" } ] }, { "id": "27822", "name": "", "equation": "hydrogen sulfide + O-acetyl-L-homoserine = acetate + L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06106-1", "Q12198-1" ], "evidence": [ { "id": "27822", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27822" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P06106", "gene_name": "MET17", "activity": [ { "ec_number": "2.5.1.47", "activity": "hydrogen sulfide + O-acetyl-L-serine = acetate + L-cysteine.", "evidence": [ { "id": "P06106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06106" } ] }, { "ec_number": "2.5.1.49", "activity": "methanethiol + O-acetyl-L-homoserine = acetate + H(+) + L-methionine.", "evidence": [ { "id": "P06106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06106" } ] }, { "ec_number": "2.5.1.47", "activity": "", "evidence": [ { "id": "P06106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06106" } ] }, { "ec_number": "2.5.1.49", "activity": "", "evidence": [ { "id": "P06106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06106" } ] } ] }, { "uniprot_ac": "P53206", "gene_name": "MCY1", "activity": [ { "ec_number": "2.5.1.47", "activity": "hydrogen sulfide + O-acetyl-L-serine = acetate + L-cysteine.", "evidence": [ { "id": "P53206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53206" } ] }, { "ec_number": "2.5.1.47", "activity": "", "evidence": [ { "id": "P53206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53206" } ] } ] }, { "uniprot_ac": "Q12198", "gene_name": "HSU1", "activity": [ { "ec_number": "2.5.1.47", "activity": "hydrogen sulfide + O-acetyl-L-serine = acetate + L-cysteine.", "evidence": [ { "id": "Q12198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12198" } ] }, { "ec_number": "2.5.1.49", "activity": "methanethiol + O-acetyl-L-homoserine = acetate + H(+) + L-methionine.", "evidence": [ { "id": "Q12198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12198" } ] }, { "ec_number": "2.5.1.47", "activity": "", "evidence": [ { "id": "Q12198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12198" } ] }, { "ec_number": "2.5.1.49", "activity": "", "evidence": [ { "id": "Q12198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12198" } ] } ] }, { "uniprot_ac": "Q54CN7", "gene_name": "cysK", "activity": [ { "ec_number": "2.5.1.47", "activity": "hydrogen sulfide + O-acetyl-L-serine = acetate + L-cysteine.", "evidence": [ { "id": "Q54CN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CN7" } ] }, { "ec_number": "2.5.1.47", "activity": "", "evidence": [ { "id": "Q54CN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CN7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }