{ "uniprot_canonical_ac": "P05317-1", "uniprot_ac": "P05317", "uniprot_id": "RLA0_YEAST", "mass": { "chemical_mass": 33717.0, "monoisotopic_mass": 33717.0 }, "refseq": { "ac": "NP_013444", "name": "ribosomal protein P0", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013444" }, "gene_names": [ { "name": "RPP0", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "L10E", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "L8300.8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "RPA0", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "RPL10E", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013444", "id": "NP_013444" }, { "name": "RPL10E", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "RPLA0", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05317", "id": "P05317" }, { "name": "RPP0", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013444", "id": "NP_013444" } ], "protein_names": [ { "name": "Large ribosomal subunit protein uL10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05317" }, { "name": "60S acidic ribosomal protein P0", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05317" }, { "name": "A0", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05317" }, { "name": "L10e", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05317" }, { "name": "ribosomal protein P0", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013444", "id": "NP_013444" } ], "function": [ { "annotation": "Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. uL10 forms part of the P stalk that participates in recruiting G proteins to the ribosome.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317#function" }, { "database": "PubMed", "id": "22096102", "url": "https://glygen.org/publication/PubMed/22096102" } ] } ], "disease": [ { "disease_id": "DOID:14250", "recommended_name": { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "Down syndrome", "description": "A chromosomal disease that is characterized by flat-looking facial features and weak muscle tone (hypotonia) in infancy and is caused by trisomy of all or a critical portion of chromosome 21 and is associated with intellectual disability." }, "synonyms": [ { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "Complete trisomy 21 syndrome", "description": "" }, { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "Down's syndrome", "description": "" }, { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "Down's syndrome - trisomy 21", "description": "" }, { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "Downs syndrome", "description": "" }, { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "G Trisomy", "description": "" }, { "id": "DOID:14250", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14250", "name": "trisomy 21 syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down syndrome", "description": "Down syndrome is a chromosomal abnormality caused by the presence of a third (partial or total) copy of the chromosome 21 genetic material and that is characterized by variable intellectual disability, muscular hypotonia, and joint laxity, often associated with a characteristic facial dysmorphism and various anomalies such as cardiac, gastrointestinal, or endocrine defects." }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down syndrome, Isolated cases", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down's syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down's syndrome - trisomy 21", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Downs syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "G trisomy", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "leukemia, megakaryoblastic, with or without Down syndrome, somatic", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "trisomy 21 (Down syndrome)", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "complete trisomy 21 syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "trisomy 21", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "trisomy 21 syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down syndrome chromosome region", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "Down syndrome critical region", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "leukemia, megakaryoblastic, of Down syndrome", "description": "" }, { "id": "MONDO:0008608", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008608", "name": "transient myeloproliferative disorder of Down syndrome", "description": "" } ], "evidence": [ { "id": "14250", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14250" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "common_name": "Yeast" } ], "gene": [ { "name": "RPP0", "url": "https://www.uniprot.org/uniprot/P05317", "locus": { "chromosome": "XII", "start_pos": 806825, "end_pos": 805887, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "YLR340W", "url": "https://www.ensembl.org/id/YLR340W" } ] } } ], "crossref": [ { "id": "cd05795", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05795", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "851052", "url": "https://www.ncbi.nlm.nih.gov/gene/851052", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P05317", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05317*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001790", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001790", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030670", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030670", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040637", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040637", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043141", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043141", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YLR340W", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR340W", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MAHVAEW", "url": "https://omabrowser.org/oma/group/MAHVAEW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168365at2759", "url": "http://www.orthodb.org/?query=168365at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45699", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45699", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45699:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45699:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3J16", "url": "https://www.rcsb.org/structure/3J16", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J77", "url": "https://www.rcsb.org/structure/3J77", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J78", "url": "https://www.rcsb.org/structure/3J78", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U3M", "url": "https://www.rcsb.org/structure/4U3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U3N", "url": "https://www.rcsb.org/structure/4U3N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U3U", "url": "https://www.rcsb.org/structure/4U3U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4N", "url": "https://www.rcsb.org/structure/4U4N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4O", "url": "https://www.rcsb.org/structure/4U4O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4Q", "url": "https://www.rcsb.org/structure/4U4Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4R", "url": "https://www.rcsb.org/structure/4U4R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4U", "url": "https://www.rcsb.org/structure/4U4U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4Y", "url": "https://www.rcsb.org/structure/4U4Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U4Z", "url": "https://www.rcsb.org/structure/4U4Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U50", "url": "https://www.rcsb.org/structure/4U50", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U51", "url": "https://www.rcsb.org/structure/4U51", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U52", "url": "https://www.rcsb.org/structure/4U52", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U53", "url": "https://www.rcsb.org/structure/4U53", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U55", "url": "https://www.rcsb.org/structure/4U55", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U56", "url": "https://www.rcsb.org/structure/4U56", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U6F", "url": "https://www.rcsb.org/structure/4U6F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V6I", "url": "https://www.rcsb.org/structure/4V6I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V7R", "url": "https://www.rcsb.org/structure/4V7R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V88", "url": "https://www.rcsb.org/structure/4V88", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V8T", "url": "https://www.rcsb.org/structure/4V8T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V8Y", "url": "https://www.rcsb.org/structure/4V8Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V8Z", "url": "https://www.rcsb.org/structure/4V8Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5APN", "url": "https://www.rcsb.org/structure/5APN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5APO", "url": "https://www.rcsb.org/structure/5APO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DAT", "url": "https://www.rcsb.org/structure/5DAT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DC3", "url": "https://www.rcsb.org/structure/5DC3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DGE", "url": "https://www.rcsb.org/structure/5DGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DGF", "url": "https://www.rcsb.org/structure/5DGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DGV", "url": "https://www.rcsb.org/structure/5DGV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FCI", "url": "https://www.rcsb.org/structure/5FCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FCJ", "url": "https://www.rcsb.org/structure/5FCJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5I4L", "url": "https://www.rcsb.org/structure/5I4L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JUO", "url": "https://www.rcsb.org/structure/5JUO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JUP", "url": "https://www.rcsb.org/structure/5JUP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JUS", "url": "https://www.rcsb.org/structure/5JUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JUT", "url": "https://www.rcsb.org/structure/5JUT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JUU", "url": "https://www.rcsb.org/structure/5JUU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LYB", "url": "https://www.rcsb.org/structure/5LYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MEI", "url": "https://www.rcsb.org/structure/5MEI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NDG", "url": "https://www.rcsb.org/structure/5NDG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OBM", "url": "https://www.rcsb.org/structure/5OBM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ON6", "url": "https://www.rcsb.org/structure/5ON6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TBW", "url": "https://www.rcsb.org/structure/5TBW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TGA", "url": "https://www.rcsb.org/structure/5TGA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TGM", "url": "https://www.rcsb.org/structure/5TGM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GQ1", "url": "https://www.rcsb.org/structure/6GQ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GQB", "url": "https://www.rcsb.org/structure/6GQB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GQV", "url": "https://www.rcsb.org/structure/6GQV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HHQ", "url": "https://www.rcsb.org/structure/6HHQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6I7O", "url": "https://www.rcsb.org/structure/6I7O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OIG", "url": "https://www.rcsb.org/structure/6OIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R84", "url": "https://www.rcsb.org/structure/6R84", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R86", "url": "https://www.rcsb.org/structure/6R86", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6R87", "url": "https://www.rcsb.org/structure/6R87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SV4", "url": "https://www.rcsb.org/structure/6SV4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6T83", "url": "https://www.rcsb.org/structure/6T83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WOO", "url": "https://www.rcsb.org/structure/6WOO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TOO", "url": "https://www.rcsb.org/structure/7TOO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TOP", "url": "https://www.rcsb.org/structure/7TOP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AAF", "url": "https://www.rcsb.org/structure/8AAF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGT", "url": "https://www.rcsb.org/structure/8AGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGU", "url": "https://www.rcsb.org/structure/8AGU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGV", "url": "https://www.rcsb.org/structure/8AGV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGW", "url": "https://www.rcsb.org/structure/8AGW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGX", "url": "https://www.rcsb.org/structure/8AGX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AGZ", "url": "https://www.rcsb.org/structure/8AGZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00428", "url": "http://pfam.xfam.org/family/PF00428", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00466", "url": "http://pfam.xfam.org/family/PF00466", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17777", "url": "http://pfam.xfam.org/family/PF17777", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P05317", "url": "http://purl.obolibrary.org/obo/PR_P05317", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_013444", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_013444", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000004332", "url": "https://www.yeastgenome.org/locus/S000004332", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05317-1", "url": "https://www.uniprot.org/uniprot/P05317-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGGIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAASYHYPEIEDLVDRIENPEKYAAAAPAATSAASGDAAPAEEAAAEEEEESDDDMGFGLFD", "length": 312, "header": "sp|P05317-1|RLA0_YEAST Isoform 1 of Large ribosomal subunit protein uL10 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPP0 PE=1 SV=2 CANONICAL=P05317-1" }, "isoforms": [ { "isoform_ac": "P05317-1", "url": "", "sequence": { "sequence": "MGGIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAASYHYPEIEDLVDRIENPEKYAAAAPAATSAASGDAAPAEEAAAEEEEESDDDMGFGLFD", "length": 312, "header": "sp|P05317-1|RLA0_YEAST Isoform 1 of Large ribosomal subunit protein uL10 OS=Saccharomyces cerevisiae S288C OX=559292 GN=RPP0 PE=1 SV=2 CANONICAL=P05317-1" }, "locus": { "chromosome": "XII", "start_pos": 806822, "end_pos": 805887, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YLR340W_mRNA", "url": "https://www.ensembl.org/id/YLR340W_mRNA" }, { "database": "Ensembl Peptide", "id": "YLR340W", "url": "https://www.ensembl.org/id/YLR340W" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 126, "end_pos": 126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ], "site_lbl": "Thr126" }, { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser134" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Thr281" }, { "start_pos": 282, "end_pos": 282, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser282" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ], "site_lbl": "Ser285" }, { "start_pos": 302, "end_pos": 302, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" }, { "database": "PubMed", "id": "9843429", "url": "https://glygen.org/publication/PubMed/9843429" }, { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" }, { "database": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ], "site_lbl": "Ser302" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" } ], "site_lbl": "Ser34" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" }, { "database": "SGD", "id": "P05317", "url": "https://www.yeastgenome.org/locus/P05317" } ], "site_lbl": "Ser68" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of a hypothetical membrane protein interactor of ribosomal phosphoprotein P0.", "journal": "J. Biosci.", "date": "2004", "authors": "Sharma S., Chakraborty T., Sehgal A., Aruna K., Balachandara S.R., Mannan A.B., Nambeesan S.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "15286401", "url": "https://glygen.org/publication/PubMed/15286401" } ] }, { "title": "Yeast ribosomal P0 protein has two separate binding sites for P1/P2 proteins.", "journal": "Mol. Microbiol.", "date": "2006", "authors": "Liljas A., Grankowski N., Krokowski D., Tchorzewski M., Abramczyk D., Boguszewska A.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "16573688", "url": "https://glygen.org/publication/PubMed/16573688" } ] }, { "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-02-13", "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "A multidimensional chromatography technology for in-depth phosphoproteome analysis.", "journal": "Mol. Cell. Proteomics", "date": "2008", "authors": "Albuquerque Claudio P, Smolka Marcus B, Payne Samuel H, Bafna Vineet, Eng Jimmy, Zhou Huilin", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "18407956", "url": "https://glygen.org/publication/PubMed/18407956" } ] }, { "title": "Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.", "journal": "Science (New York, N.Y.)", "date": "2009-09-25", "authors": "Holt Liam J, Tuch Brian B, Vill\u00e9n Judit, Johnson Alexander D, Gygi Steven P, Morgan David O", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "19779198", "url": "https://glygen.org/publication/PubMed/19779198" } ] }, { "title": "High-accuracy identification and bioinformatic analysis of in vivo protein phosphorylation sites in yeast.", "journal": "Proteomics", "date": "2009-10", "authors": "Gnad Florian, de Godoy Lyris M F, Cox J\u00fcrgen, Neuhauser Nadin, Ren Shubin, Olsen Jesper V, Mann Matthias", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "19795423", "url": "https://glygen.org/publication/PubMed/19795423" } ] }, { "title": "Global analysis of the yeast osmotic stress response by quantitative proteomics.", "journal": "Molecular bioSystems", "date": "2009-11", "authors": "Soufi Boumediene, Kelstrup Christian D, Stoehr Gabriele, Fr\u00f6hlich Florian, Walther Tobias C, Olsen Jesper V", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "19823750", "url": "https://glygen.org/publication/PubMed/19823750" } ] }, { "title": "Crystal structure of the eukaryotic ribosome.", "journal": "Science", "date": "2010", "authors": "Jenner L., Yusupov M., Ben-Shem A., Yusupova G.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "21109664", "url": "https://glygen.org/publication/PubMed/21109664" } ] }, { "title": "Perturbation of the yeast N-acetyltransferase NatB induces elevation of protein phosphorylation levels.", "journal": "BMC genomics", "date": "2010-12-02", "authors": "Helbig Andreas O, Rosati Sara, Pijnappel Pim W W M, van Breukelen Bas, Timmers Marc H T H, Mohammed Shabaz, Slijper Monique, Heck Albert J R", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "21126336", "url": "https://glygen.org/publication/PubMed/21126336" } ] }, { "title": "The structure of the eukaryotic ribosome at 3.0 A resolution.", "journal": "Science", "date": "2011", "authors": "Jenner L., Yusupov M., Ben-Shem A., Garreau de Loubresse N., Melnikov S., Yusupova G.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "22096102", "url": "https://glygen.org/publication/PubMed/22096102" } ] }, { "title": "Sites of ubiquitin attachment in Saccharomyces cerevisiae.", "journal": "Proteomics", "date": "2012", "authors": "Eng J.K., Fields S., Lo R.S., Starita L.M., von Haller P.D.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "22106047", "url": "https://glygen.org/publication/PubMed/22106047" } ] }, { "title": "Global analysis of phosphorylation and ubiquitylation cross-talk in protein degradation.", "journal": "Nature methods", "date": "2013-07", "authors": "Swaney Danielle L, Beltrao Pedro, Starita Lea, Guo Ailan, Rush John, Fields Stanley, Krogan Nevan J, Vill\u00e9n Judit", "evidence": [ { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "23749301", "url": "https://glygen.org/publication/PubMed/23749301" } ] }, { "title": "A family of genes encode the multiple forms of the Saccharomyces cerevisiae ribosomal proteins equivalent to the Escherichia coli L12 protein and a single form of the L10-equivalent ribosomal protein.", "journal": "J. Bacteriol.", "date": "1990", "authors": "Shimmin L.C., Yee J., Dennis P.P., Newton C.H.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "2404943", "url": "https://glygen.org/publication/PubMed/2404943" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "A new system for naming ribosomal proteins.", "journal": "Curr. Opin. Struct. Biol.", "date": "2014", "authors": "Ban N., Ramakrishnan V., Dinman J.D., Liljas A., Ortega J., Steitz T.A., Wilson D., Dragon F., Beckmann R., Warren A.J., Tollervey D., Lipton J.M., Tchorzewski M., Cate J.H.D., Ellis S.R., Lafontaine D.L.J., Lindahl L., McAlear M.A., Moore P.B., Noller H.F., Panse V.G., Spahn C.M.T., Williamson J.R., Yonath A., Yusupov M.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "24524803", "url": "https://glygen.org/publication/PubMed/24524803" } ] }, { "title": "The gene and the primary structure of acidic ribosomal protein A0 from yeast Saccharomyces cerevisiae which shows partial homology to bacterial ribosomal protein L10.", "journal": "J. Biochem.", "date": "1989", "authors": "Nakagawa T., Mitsui K., Tsurugi K.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "2681177", "url": "https://glygen.org/publication/PubMed/2681177" } ] }, { "title": "cDNA and deduced amino acid sequence of 38 kDa-type acidic ribosomal protein A0 from Saccharomyces cerevisiae.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Mitsui K., Tsurugi K.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "3287327", "url": "https://glygen.org/publication/PubMed/3287327" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.", "journal": "Nature", "date": "1997", "authors": "Ansorge W., Duesterhoeft A., Hillier L.W., Mewes H.-W., Obermaier B., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Rose M., Benes V., Brueckner M., Rieger M., Portetelle D., Delius H., Schwarz S., Kleine K., Floeth M., Schwager C., Voss H., Hoheisel J.D., Dubois E., Volckaert G., Andre B., Koetter P., Entian K.-D., Louis E.J., Vandenbol M., Johnston M., Pohl T.M., Goffeau A., Hani J., Hilger F., Messenguy F., Miosga T., Mueller-Auer S., Scherens B., Zimmermann F.K., Zollner A., Purnelle B., Urrestarazu L.A., Vierendeels F., Voet M., Albermann K., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Moestl D., Nentwich U., Piravandi E., Rechmann S., Riles L., Rinke M., Scholler P., Underwood A.P., Wedler E.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "9169871", "url": "https://glygen.org/publication/PubMed/9169871" } ] }, { "title": "The list of cytoplasmic ribosomal proteins of Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1998", "authors": "Mager W.H., Planta R.J.", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "reference": [ { "type": "PubMed", "id": "9559554", "url": "https://glygen.org/publication/PubMed/9559554" } ] }, { "title": "Phosphorylation of ribosomal protein P0 is not essential for ribosome function but can affect translation.", "journal": "Biochemistry", "date": "1998", "authors": "Rodriguez-Gabriel M A, Remacha M, Ballesta J P", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" }, { "database": "iPTMnet", "id": "P05317", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05317" } ], "reference": [ { "type": "PubMed", "id": "9843429", "url": "https://glygen.org/publication/PubMed/9843429" } ] } ], "pathway": [ { "id": "sce:YLR340W", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YLR340W", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P05388-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RPLP0", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD", "length": 317 }, "evidence": [ { "id": "P05317", "url": "https://omabrowser.org/oma/group/P05317/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P14869-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "Rplp0", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGLFD", "length": 317 }, "evidence": [ { "id": "P05317", "url": "https://omabrowser.org/oma/group/P05317/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P19889-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RpLP0", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTEVEFKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKPESESEEEDDDMGFGLFD", "length": 317 }, "evidence": [ { "id": "P05317", "url": "https://omabrowser.org/oma/group/P05317/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P19945-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "Rplp0", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYSPEVLDITEQALHTRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFAAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD", "length": 317 }, "evidence": [ { "id": "P05317", "url": "https://omabrowser.org/oma/group/P05317/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" }, { "name": "90S preribosome", "id": "GO:0030686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030686", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" }, { "name": "cytosolic large ribosomal subunit", "id": "GO:0022625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022625", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cytoplasmic translation", "id": "GO:0002181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002181", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" }, { "name": "ribosomal large subunit assembly", "id": "GO:0000027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000027", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" }, { "name": "large ribosomal subunit rRNA binding", "id": "GO:0070180", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070180", "evidence": [ { "database": "UniProtKB", "id": "P05317", "url": "https://www.uniprot.org/uniprot/P05317" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 177, "end_pos": 179, "annotation": "n_glycosylation_sequon" }, { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }