{ "uniprot_canonical_ac": "P04633-1", "uniprot_ac": "P04633", "uniprot_id": "UCP1_RAT", "mass": { "chemical_mass": 33212.0, "monoisotopic_mass": 33212.0 }, "refseq": { "ac": "NP_036814", "name": "mitochondrial brown fat uncoupling protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, "gene_names": [ { "name": "Ucp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04633", "id": "P04633" }, { "name": "Slc25a7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04633", "id": "P04633" }, { "name": "Ucp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814", "id": "NP_036814" }, { "name": "Ucp; Ucpa; Uncp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814", "id": "NP_036814" }, { "name": "Ucp", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04633", "id": "P04633" } ], "protein_names": [ { "name": "Mitochondrial brown fat uncoupling protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04633" }, { "name": "Solute carrier family 25 member 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04633" }, { "name": "Thermogenin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04633" }, { "name": "UCP 1; solute carrier family 25 member 7; thermogenin; uncoupling protein 1 (mitochondrial, proton carrier); mitochondrial brown fat uncoupling protein 1-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814", "id": "NP_036814" }, { "name": "UCP 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04633" }, { "name": "mitochondrial brown fat uncoupling protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814", "id": "NP_036814" } ], "function": [ { "annotation": "Instead of UCP1-mediated mitochondrial uncoupling, cold acclimation increased the capacity of Sc Ing adipocytes to export fatty acids.", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, { "database": "PubMed", "id": "30624981", "url": "https://glygen.org/publication/PubMed/30624981" } ] }, { "annotation": "Maternal Roux-en-Y gastric bypass surgery reduces lipid deposition and increases UCP1 expression in the brown adipose tissue of male offspring. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, { "database": "PubMed", "id": "33441773", "url": "https://glygen.org/publication/PubMed/33441773" } ] }, { "annotation": "Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs (PubMed:12479871, PubMed:16814247, PubMed:22952235). Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633#function" }, { "database": "PubMed", "id": "16814247", "url": "https://glygen.org/publication/PubMed/16814247" }, { "database": "UniProtKB", "id": "P12242", "url": "https://www.uniprot.org/uniprot/P12242#function" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" }, { "database": "PubMed", "id": "22952235", "url": "https://glygen.org/publication/PubMed/22952235" } ] }, { "annotation": "NT3/TrkC Pathway Modulates the Expression of UCP-1 and Adipocyte Size in Human and Rodent Adipose Tissue. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, { "database": "PubMed", "id": "33815288", "url": "https://glygen.org/publication/PubMed/33815288" } ] }, { "annotation": "Rats lacking Ucp1 present a novel translational tool for the investigation of thermogenic adaptation during cold challenge.", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, { "database": "PubMed", "id": "36650072", "url": "https://glygen.org/publication/PubMed/36650072" } ] }, { "annotation": "Structural models of mitochondrial uncoupling proteins obtained in DPC micelles are not functionally relevant.", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" }, { "database": "PubMed", "id": "33202085", "url": "https://glygen.org/publication/PubMed/33202085" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:11716", "recommended_name": { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "prediabetes syndrome", "description": "A glucose metabolism disease that is characterized by blood glucose levels are high, but not high enough to be classified as type 2 diabetes." }, "synonyms": [ { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "Prediabetes", "description": "" }, { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "prediabetic state", "description": "" }, { "id": "DOID:11716", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11716", "name": "impaired glucose tolerance", "description": "" } ], "evidence": [ { "id": "11716", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11716" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 146, "end_pos": 146, "sequence_org": "H", "sequence_mut": "L", "comment": "No effect on GTP-binding. Decreased fatty acid-induced proton transport; when associated with L-148.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "start_pos": 148, "end_pos": 148, "sequence_org": "H", "sequence_mut": "L", "comment": "No effect on GTP-binding. Decreased fatty acid-induced proton transport; when associated with L-146.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "start_pos": 153, "end_pos": 153, "sequence_org": "R", "sequence_mut": "L", "comment": "No effect on GTP-binding. Decreased fatty acid-induced proton transport.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "start_pos": 25, "end_pos": 25, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on GTP-binding. Loss of fatty acid-induced proton transport; when associated with V-28 and A-31.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "start_pos": 28, "end_pos": 28, "sequence_org": "D", "sequence_mut": "V", "comment": "No effect on GTP-binding. Decreased fatty acid-induced proton transport. Loss of fatty acid-induced proton transport; when associated with A-25 and A-31.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "start_pos": 31, "end_pos": 31, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on GTP-binding. No effect on fatty acid-induced proton transport. Loss of fatty acid-induced proton transport; when associated with A-25 and V-28.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ucp1", "url": "https://www.uniprot.org/uniprot/P04633", "locus": { "chromosome": "19", "start_pos": 24808783, "end_pos": 24816852, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003580", "url": "https://www.ensembl.org/id/ENSRNOG00000003580" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003580", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003580", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "24860", "url": "https://www.ncbi.nlm.nih.gov/gene/24860", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:24860", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24860", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NCAMKMF", "url": "https://omabrowser.org/oma/group/NCAMKMF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1832865at2759", "url": "http://www.orthodb.org/?query=1832865at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45618", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45618", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45618:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45618:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00153", "url": "http://pfam.xfam.org/family/PF00153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P04633", "url": "http://purl.obolibrary.org/obo/PR_P04633", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-167826", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-167826", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-167827", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-167827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "3931", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=3931", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "34979", "url": "https://www.rhea-db.org/rhea/34979", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04633-1", "url": "https://www.uniprot.org/uniprot/P04633-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT", "length": 307, "header": "sp|P04633-1|UCP1_RAT Isoform 1 of Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus OX=10116 GN=Ucp1 PE=1 SV=2 CANONICAL=P04633-1" }, "isoforms": [ { "isoform_ac": "P04633-1", "url": "", "sequence": { "sequence": "MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT", "length": 307, "header": "sp|P04633-1|UCP1_RAT Isoform 1 of Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus OX=10116 GN=Ucp1 PE=1 SV=2 CANONICAL=P04633-1" }, "locus": { "chromosome": "19", "start_pos": 24816672, "end_pos": 24808879, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000004900", "url": "https://www.ensembl.org/id/ENSRNOT00000004900" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000004900", "url": "https://www.ensembl.org/id/ENSRNOP00000004900" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Substitutional mutations in the uncoupling protein-specific sequences of mitochondrial uncoupling protein UCP1 lead to the reduction of fatty acid-induced H+ uniport.", "journal": "Int. J. Biochem. Cell Biol.", "date": "2003", "authors": "Urbankova E, Hanak P, Skobisova E, Ruzicka M, Jezek P", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "12479871", "url": "https://glygen.org/publication/PubMed/12479871" } ] }, { "title": "Fatty acid activation of the uncoupling proteins requires the presence of the central matrix loop from UCP1.", "journal": "Biochim. Biophys. Acta", "date": "2006", "authors": "Gonzalez-Barroso M.M., Jimenez-Jimenez J., Ledesma A., Rial E., Zaragoza P.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "16814247", "url": "https://glygen.org/publication/PubMed/16814247" } ] }, { "title": "A role for ubiquitinylation and the cytosolic proteasome in turnover of mitochondrial uncoupling protein 1 (UCP1).", "journal": "Biochim. Biophys. Acta", "date": "2012", "authors": "Clarke KJ, Adams AE, Manzke LH, Pearson TW, Borchers CH, Porter RK", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "22531154", "url": "https://glygen.org/publication/PubMed/22531154" } ] }, { "title": "Fatty acids change the conformation of uncoupling protein 1 (UCP1).", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Brand M.D., Divakaruni A.S., Humphrey D.M.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "22952235", "url": "https://glygen.org/publication/PubMed/22952235" } ] }, { "title": "Immunological detection of cDNA clones encoding the uncoupling protein of brown adipose tissue: evidence for an antigenic determinant within the C-terminal eleven amino acids.", "journal": "Biosci. Rep.", "date": "1986", "authors": "Freeman K.B., Patel H.V., Ridley R.G., Parfett C.L., Olynyk K.A., Reichling S.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "2421800", "url": "https://glygen.org/publication/PubMed/2421800" } ] }, { "title": "Complete nucleotide and derived amino acid sequence of cDNA encoding the mitochondrial uncoupling protein of rat brown adipose tissue: lack of a mitochondrial targeting presequence.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Freeman K.B., Patel H.V., Ridley R.G., Gerber G.E., Morton R.C.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "3012461", "url": "https://glygen.org/publication/PubMed/3012461" } ] }, { "title": "Cold acclimation enhances UCP1 content, lipolysis, and triacylglycerol resynthesis, but not mitochondrial uncoupling and fat oxidation, in rat white adipocytes.", "journal": "American journal of physiology. Cell physiology", "date": "2019", "authors": "Sepa-Kishi DM, Jani S, Da Eira D, Ceddia RB", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" } ], "reference": [ { "type": "PubMed", "id": "30624981", "url": "https://glygen.org/publication/PubMed/30624981" } ] }, { "title": "The gene for rat uncoupling protein: complete sequence, structure of primary transcript and evolutionary relationship between exons.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1988", "authors": "Bouillaud F, Raimbault S, Ricquier D", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "3202878", "url": "https://glygen.org/publication/PubMed/3202878" } ] }, { "title": "Structural models of mitochondrial uncoupling proteins obtained in DPC micelles are not functionally relevant.", "journal": "The FEBS journal", "date": "2021", "authors": "Piel MS, Masscheleyn S, Bouillaud F, Moncoq K, Miroux B", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" } ], "reference": [ { "type": "PubMed", "id": "33202085", "url": "https://glygen.org/publication/PubMed/33202085" } ] }, { "title": "Maternal Roux-en-Y gastric bypass surgery reduces lipid deposition and increases UCP1 expression in the brown adipose tissue of male offspring.", "journal": "Scientific reports", "date": "2021", "authors": "Ceglarek VM, Bertasso IM, Pietrobon CB, Scomazzon SP, Leite NC, Bonfleur ML, Araujo ACF, Balbo SL, Grassiolli S", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" } ], "reference": [ { "type": "PubMed", "id": "33441773", "url": "https://glygen.org/publication/PubMed/33441773" } ] }, { "title": "NT3/TrkC Pathway Modulates the Expression of UCP-1 and Adipocyte Size in Human and Rodent Adipose Tissue.", "journal": "Frontiers in endocrinology", "date": "2021", "authors": "Bove M, Monto F, Guillem-Llobat P, Ivorra MD, Noguera MA, Zambrano A, Sirerol-Piquer MS, Requena AC, Garcia-Alonso M, Tejerina T, Real JT, Farinas I, D'Ocon P", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" } ], "reference": [ { "type": "PubMed", "id": "33815288", "url": "https://glygen.org/publication/PubMed/33815288" } ] }, { "title": "Rats lacking Ucp1 present a novel translational tool for the investigation of thermogenic adaptation during cold challenge.", "journal": "Acta physiologica (Oxford, England)", "date": "2023-01-17", "authors": "Warfel Jaycob D, Elks Carrie M, Bayless David S, Vandanmagsar Bolormaa, Stone Allison C, Velasquez Samuel E, Olivares-Nazar Paola, Noland Robert C, Ghosh Sujoy, Zhang Jingying, Mynatt Randall L", "evidence": [ { "database": "RefSeq", "id": "NP_036814", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036814" } ], "reference": [ { "type": "PubMed", "id": "36650072", "url": "https://glygen.org/publication/PubMed/36650072" } ] }, { "title": "Complete cDNA-derived amino acid sequence of rat brown fat uncoupling protein.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Weissenbach J., Bouillaud F., Ricquier D.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "3753702", "url": "https://glygen.org/publication/PubMed/3753702" } ] }, { "title": "The topology of the brown adipose tissue mitochondrial uncoupling protein determined with antibodies against its antigenic sites revealed by a library of fusion proteins.", "journal": "EMBO J.", "date": "1993", "authors": "Miroux B, Frossard V, Raimbault S, Ricquier D, Bouillaud F", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "reference": [ { "type": "PubMed", "id": "7691596", "url": "https://glygen.org/publication/PubMed/7691596" } ] } ], "pathway": [ { "id": "rno:24860", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:24860", "resource": "KEGG Pathway" }, { "id": "R-RNO-167826", "name": "The fatty acid cycling model", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-167826", "resource": "Reactome", "description": "The fatty acid cycling model" }, { "id": "R-RNO-167827", "name": "The proton buffering model", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-167827", "resource": "Reactome", "description": "The proton buffering model" } ], "orthologs": [ { "uniprot_canonical_ac": "P12242-1", "protein_name": "Mitochondrial brown fat uncoupling protein 1", "gene_name": "Ucp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT", "length": 307 }, "evidence": [ { "id": "45224270", "url": "http://www.informatics.jax.org/homology/45224270", "database": "MGI" }, { "id": "P04633", "url": "https://omabrowser.org/oma/group/P04633/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P25874-1", "protein_name": "Mitochondrial brown fat uncoupling protein 1", "gene_name": "UCP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT", "length": 307 }, "evidence": [ { "id": "45224270", "url": "http://www.informatics.jax.org/homology/45224270", "database": "MGI" }, { "id": "P04633", "url": "https://omabrowser.org/oma/group/P04633/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 19, "go_terms": [ { "name": "cellular response to cold", "id": "GO:0070417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070417", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "positive regulation of metabolic process", "id": "GO:0009893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009893", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "generation of precursor metabolites and energy", "id": "GO:0006091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006091", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "mitochondrial transport", "id": "GO:0006839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006839", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "response to cold", "id": "GO:0009409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009409", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "brown fat cell differentiation", "id": "GO:0050873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050873", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "response to temperature stimulus", "id": "GO:0009266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009266", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "cellular response to hormone stimulus", "id": "GO:0032870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032870", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "diet induced thermogenesis", "id": "GO:0002024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002024", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "cellular response to reactive oxygen species", "id": "GO:0034614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034614", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "regulation of reactive oxygen species biosynthetic process", "id": "GO:1903426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903426", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "cellular response to fatty acid", "id": "GO:0071398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071398", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "adaptive thermogenesis", "id": "GO:1990845", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990845", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "proton transmembrane transport", "id": "GO:1902600", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902600", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "positive regulation of cold-induced thermogenesis", "id": "GO:0120162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120162", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "mitochondrial transmembrane transport", "id": "GO:1990542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990542", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "cellular response to dehydroepiandrosterone", "id": "GO:1903495", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903495", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "long-chain fatty acid binding", "id": "GO:0036041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036041", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "proton transmembrane transporter activity", "id": "GO:0015078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015078", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "cardiolipin binding", "id": "GO:1901612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901612", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "oxidative phosphorylation uncoupler activity", "id": "GO:0017077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017077", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "purine ribonucleotide binding", "id": "GO:0032555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032555", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "mitochondrial envelope", "id": "GO:0005740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005740", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "May undergo sulfenylation upon cold exposure. May increase the sensitivity of UCP1 thermogenic function to the activation by noradrenaline probably through structural effects.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "P12242", "url": "https://glygen.org/publication/PubMed/P12242" } ] }, { "annotation": "May undergo ubiquitin-mediated proteasomal degradation.", "evidence": [ { "database": "UniProtKB", "id": "P04633", "url": "https://www.uniprot.org/uniprot/P04633" }, { "database": "PubMed", "id": "22531154", "url": "https://glygen.org/publication/PubMed/22531154" } ] } ], "interactions": [], "reactions": [ { "id": "34979", "name": "", "equation": "H(+)(in) = H(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "34979", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/34979" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }