{ "uniprot_canonical_ac": "P04628-1", "uniprot_ac": "P04628", "uniprot_id": "WNT1_HUMAN", "mass": { "chemical_mass": 40982.0, "monoisotopic_mass": 40982.0 }, "refseq": { "ac": "NP_005421", "name": "proto-oncogene Wnt-1 precursor", "summary": "The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, "gene_names": [ { "name": "WNT1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04628", "id": "P04628" }, { "name": "BMND16; INT1; OI15", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421", "id": "NP_005421" }, { "name": "INT1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04628", "id": "P04628" }, { "name": "WNT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421", "id": "NP_005421" } ], "protein_names": [ { "name": "Proto-oncogene Wnt-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04628" }, { "name": "Proto-oncogene Int-1 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04628" }, { "name": "proto-oncogene Wnt-1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421", "id": "NP_005421" }, { "name": "wingless-type MMTV integration site family, member 1 (oncogene INT1); proto-oncogene Int-1 homolog; wingless-type MMTV integration site family member 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421", "id": "NP_005421" } ], "function": [ { "annotation": "Association of Membranous WNT-1 and Nuclear mTOR with Endometrial Cancer Grade. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, { "database": "PubMed", "id": "37176048", "url": "https://glygen.org/publication/PubMed/37176048" } ] }, { "annotation": "Genotypic and Phenotypic Spectrum and Pathogenesis of WNT1 Variants in a Large Cohort of Patients With OI/Osteoporosis.", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, { "database": "PubMed", "id": "36595228", "url": "https://glygen.org/publication/PubMed/36595228" } ] }, { "annotation": "KLF3 Transcription Activates WNT1 and Promotes the Growth and Metastasis of Gastric Cancer via Activation of the WNT/beta-Catenin Signaling Pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, { "database": "PubMed", "id": "36827869", "url": "https://glygen.org/publication/PubMed/36827869" } ] }, { "annotation": "Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (PubMed:23499309, PubMed:26902720, PubMed:28528193, PubMed:23656646). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (By similarity). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis (PubMed:23499309, PubMed:23656646).", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628#function" }, { "database": "PubMed", "id": "28528193", "url": "https://glygen.org/publication/PubMed/28528193" }, { "database": "UniProtKB", "id": "P04426", "url": "https://www.uniprot.org/uniprot/P04426#function" }, { "database": "PubMed", "id": "23499309", "url": "https://glygen.org/publication/PubMed/23499309" }, { "database": "PubMed", "id": "26902720", "url": "https://glygen.org/publication/PubMed/26902720" }, { "database": "PubMed", "id": "23656646", "url": "https://glygen.org/publication/PubMed/23656646" } ] }, { "annotation": "Osteoporosis related to WNT1 variants: a not infrequent cause of osteoporosis.", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, { "database": "PubMed", "id": "36396825", "url": "https://glygen.org/publication/PubMed/36396825" } ] }, { "annotation": "The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ] }, { "annotation": "Wnt/beta-catenin signaling and its modulators in nonalcoholic fatty liver diseases. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" }, { "database": "PubMed", "id": "36448560", "url": "https://glygen.org/publication/PubMed/36448560" } ] } ], "disease": [ { "disease_id": "DOID:0110347", "recommended_name": { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "osteogenesis imperfecta type 15", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the WNT1 gene on chromosome 12q13." }, "synonyms": [ { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "OI15", "description": "" }, { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "osteogenesis imperfecta type XV", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta type 15", "description": "Any osteogenesis imperfecta in which the cause of the disease is a mutation in the WNT1 gene." }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "OI15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "WNT1 osteogenesis imperfecta", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta caused by mutation in WNT1", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta type XV", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "OI, type 15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta, type 15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta, type XV", "description": "" }, { "id": "MIM:615220", "resource": "MIM", "url": "https://www.omim.org/entry/615220", "name": "Osteogenesis imperfecta 15", "description": "Osteogenesis imperfecta 15" } ], "evidence": [ { "id": "615220", "database": "MIM", "url": "https://www.omim.org/entry/615220" } ] }, { "disease_id": "DOID:11476", "recommended_name": { "id": "DOID:11476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11476", "name": "osteoporosis", "description": "A bone resorption disease characterized by decreased density of normally mineralized bone which results_in the thinning of bone tissue and decreased mechanical strength." }, "synonyms": [ { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis", "description": "A condition of reduced bone mass, with decreased cortical thickness and a decrease in the number and size of the trabeculae of cancellous bone (but normal chemical composition), resulting in increased fracture incidence. Osteoporosis is classified as primary (Type 1, postmenopausal osteoporosis; Type 2, age-associated osteoporosis; and idiopathic, which can affect juveniles, premenopausal women, and middle-aged men) and secondary osteoporosis (which results from an identifiable cause of bone mass loss)." }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "bone mineral density variation QTL, osteoporosis", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, postmenopausal", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, postmenopausal, susceptibility", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, susceptibility to", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "fracture, hip, susceptibility to", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, involutional", "description": "" }, { "id": "MIM:166710", "resource": "MIM", "url": "https://www.omim.org/entry/166710", "name": "Osteoporosis", "description": "Osteoporosis" } ], "evidence": [ { "id": "166710", "database": "MIM", "url": "https://www.omim.org/entry/166710" } ] }, { "disease_id": "DOID:12559", "recommended_name": { "id": "DOID:12559", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12559", "name": "idiopathic juvenile osteoporosis", "description": "An osteoporosis with no known cause that is characterized by pain in the back and extremities, walking difficulties, multiple fractures, and radiological evidence of osteoporosis." }, "synonyms": [ { "id": "DOID:12559", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12559", "name": "Idiopathic osteoporosis", "description": "" }, { "id": "DOID:12559", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12559", "name": "juvenile osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic juvenile osteoporosis", "description": "Idiopathic juvenile osteoporosis (IJO) is a primary condition of bone demineralization childhood or adolescence that presents with pain in the back and extremities, walking difficulties, multiple fractures, and radiological evidence of osteoporosis. Onset usually occurs in the prepubertal period, between 8 and 12 years of age." }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Ijo", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Paediatric osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Pediatric osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic juvenile osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "juvenile osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "osteoporosis, juvenile", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic juvenile osteoporosis", "description": "Idiopathic juvenile osteoporosis (IJO) is a primary condition of bone demineralization childhood or adolescence that presents with pain in the back and extremities, walking difficulties, multiple fractures, and radiological evidence of osteoporosis. Onset usually occurs in the prepubertal period, between 8 and 12 years of age." }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Ijo", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Paediatric osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "Pediatric osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic juvenile osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "idiopathic osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "juvenile osteoporosis", "description": "" }, { "id": "MONDO:0019409", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019409", "name": "osteoporosis, juvenile", "description": "" } ], "evidence": [ { "id": "615221", "database": "MIM", "url": "https://www.omim.org/entry/615221" } ] } ], "snv": [ { "evidence": [ { "id": "P04628", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04628" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 205, "end_pos": 205, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NEA->NES).", "chr_id": "12", "chr_pos": "48980678", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A205", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1200766008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1200766008" }, { "id": "rs1200766008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1200766008#frequency_tab" }, { "id": "rs1200766008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1200766008" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 262, "end_pos": 262, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRG->NRS).", "chr_id": "12", "chr_pos": "48981311", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G262", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1236713622", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1236713622" }, { "id": "rs1236713622", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1236713622" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 266, "end_pos": 266, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRA->NRS).", "chr_id": "12", "chr_pos": "48981323", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A266", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs387907357", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387907357" }, { "id": "23434763", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23434763" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 317, "end_pos": 317, "sequence_org": "S", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NnullS).", "chr_id": "12", "chr_pos": "48981473_48981476", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S317", "disease": [ { "disease_id": "DOID:0110347", "recommended_name": { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "osteogenesis imperfecta type 15", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the WNT1 gene on chromosome 12q13." }, "synonyms": [ { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "OI15", "description": "" }, { "id": "DOID:0110347", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110347", "name": "osteogenesis imperfecta type XV", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta type 15", "description": "Any osteogenesis imperfecta in which the cause of the disease is a mutation in the WNT1 gene." }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "OI15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "WNT1 osteogenesis imperfecta", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta caused by mutation in WNT1", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta type XV", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "OI, type 15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta, type 15", "description": "" }, { "id": "MONDO:0014086", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014086", "name": "osteogenesis imperfecta, type XV", "description": "" }, { "id": "MIM:615220", "resource": "MIM", "url": "https://www.omim.org/entry/615220", "name": "Osteogenesis imperfecta 15", "description": "Osteogenesis imperfecta 15" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs976018078", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs976018078" }, { "id": "rs976018078", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs976018078#frequency_tab" }, { "id": "rs976018078", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs976018078" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 318, "end_pos": 318, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NS*).", "chr_id": "12", "chr_pos": "48981480", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S318", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs976018078", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs976018078" }, { "id": "rs976018078", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs976018078#frequency_tab" }, { "id": "rs976018078", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs976018078" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 318, "end_pos": 318, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSL).", "chr_id": "12", "chr_pos": "48981480", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S318", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1293116487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1293116487" }, { "id": "rs1293116487", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1293116487" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 348, "end_pos": 348, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCI).", "chr_id": "12", "chr_pos": "48981570", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T348", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754298019", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754298019" }, { "id": "rs754298019", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754298019" }, { "id": "rs754298019", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754298019" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 348, "end_pos": 348, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCP).", "chr_id": "12", "chr_pos": "48981569", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T348", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748636854", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748636854" }, { "id": "rs748636854", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748636854" }, { "id": "rs748636854", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748636854" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 359, "end_pos": 359, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->DCT).", "chr_id": "12", "chr_pos": "48981602", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N359", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771546038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771546038" }, { "id": "rs771546038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771546038" }, { "id": "rs771546038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771546038#frequency_tab" }, { "id": "rs771546038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771546038" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 359, "end_pos": 359, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "12", "chr_pos": "48981603", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N359", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs930178892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs930178892" }, { "id": "rs930178892", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs930178892#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 361, "end_pos": 361, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCM).", "chr_id": "12", "chr_pos": "48981609", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T361", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "28.24", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "43.93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "48.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "30.79", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "33.03", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "43.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "26.75", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "46.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "45.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04628" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "common_name": "Human" } ], "gene": [ { "name": "WNT1", "url": "https://www.uniprot.org/uniprot/P04628", "locus": { "chromosome": "12", "start_pos": 48982620, "end_pos": 48978322, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000125084", "url": "https://www.ensembl.org/id/ENSG00000125084" } ] } } ], "crossref": [ { "id": "ENSG00000125084", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125084", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P04628", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04628", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd19333", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19333", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "WNT1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=WNT1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "7471", "url": "https://www.ncbi.nlm.nih.gov/gene/7471", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12774", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12774", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04628", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04628*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005817", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005817", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009139", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009139", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018161", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018161", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043158", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043158", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7471", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7471", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164820", "url": "http://www.omim.org/entry/164820", "database": "MIM", "categories": [ "Other" ] }, { "id": "166710", "url": "http://www.omim.org/entry/166710", "database": "MIM", "categories": [ "Other" ] }, { "id": "615220", "url": "http://www.omim.org/entry/615220", "database": "MIM", "categories": [ "Other" ] }, { "id": "615221", "url": "http://www.omim.org/entry/615221", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04628", "url": "https://www.nextprot.org/entry/NX_P04628", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "WALLPSW", "url": "https://omabrowser.org/oma/group/WALLPSW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2874082at2759", "url": "http://www.orthodb.org/?query=2874082at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12027", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12027", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12027:SF91", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12027:SF91", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00110", "url": "http://pfam.xfam.org/family/PF00110", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04628", "url": "https://pharos.nih.gov/targets/P04628", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04628", "url": "http://purl.obolibrary.org/obo/PR_P04628", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04628-1", "url": "https://www.uniprot.org/uniprot/P04628-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL", "length": 370, "header": "sp|P04628-1|WNT1_HUMAN Isoform 1 of Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WNT1 PE=1 SV=1 CANONICAL=P04628-1" }, "isoforms": [ { "isoform_ac": "P04628-1", "url": "", "sequence": { "sequence": "MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL", "length": 370, "header": "sp|P04628-1|WNT1_HUMAN Isoform 1 of Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WNT1 PE=1 SV=1 CANONICAL=P04628-1" }, "locus": { "chromosome": "12", "start_pos": 48981637, "end_pos": 48978651, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000293549.4", "url": "https://www.ensembl.org/id/ENST00000293549.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000293549.3", "url": "https://www.ensembl.org/id/ENSP00000293549.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 29, "start_aa": "Asn", "end_pos": 29, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn29", "evidence": [ { "id": "P04628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04628#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 316, "start_aa": "Asn", "end_pos": 316, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn316", "evidence": [ { "id": "P04628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04628#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "P04628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04628#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 359, "start_aa": "Asn", "end_pos": 359, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn359", "evidence": [ { "id": "P04628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04628#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "p300 interacts with the N- and C-terminal part of PPARgamma2 in a ligand-independent and -dependent manner, respectively.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gelman L, Zhou G, Fajas L, Raspe E, Fruchart JC, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10075656", "url": "https://glygen.org/publication/PubMed/10075656" } ] }, { "title": "Biochemical characterization of Wnt-frizzled interactions using a soluble, biologically active vertebrate Wnt protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Hsieh JC, Rattner A, Smallwood PM, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "10097073", "url": "https://glygen.org/publication/PubMed/10097073" } ] }, { "title": "beta-catenin can be transported into the nucleus in a Ran-unassisted manner.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Yokoya F, Imamoto N, Tachibana T, Yoneda Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "10198061", "url": "https://glygen.org/publication/PubMed/10198061" } ] }, { "title": "Wnt-induced dephosphorylation of axin releases beta-catenin from the axin complex.", "journal": "Genes & development", "date": "1999", "authors": "Willert K, Shibamoto S, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10421629", "url": "https://glygen.org/publication/PubMed/10421629" } ] }, { "title": "PPARgamma activation induces the expression of the adipocyte fatty acid binding protein gene in human monocytes.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Pelton PD, Zhou L, Demarest KT, Burris TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "10425206", "url": "https://glygen.org/publication/PubMed/10425206" } ] }, { "title": "Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1.", "journal": "The EMBO journal", "date": "1999", "authors": "Li L, Yuan H, Weaver CD, Mao J, Farr GH 3rd, Sussman DJ, Jonkers J, Kimelman D, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10428961", "url": "https://glygen.org/publication/PubMed/10428961" } ] }, { "title": "A GSK3-binding peptide from FRAT1 selectively inhibits the GSK3-catalysed phosphorylation of axin and beta-catenin.", "journal": "FEBS letters", "date": "1999", "authors": "Thomas GM, Frame S, Goedert M, Nathke I, Polakis P, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10481074", "url": "https://glygen.org/publication/PubMed/10481074" } ] }, { "title": "A GSK3beta phosphorylation site in axin modulates interaction with beta-catenin and Tcf-mediated gene expression.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Jho Eh, Lomvardas S, Costantini F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10581160", "url": "https://glygen.org/publication/PubMed/10581160" } ] }, { "title": "Interaction among GSK-3, GBP, axin, and APC in Xenopus axis specification.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Farr GH 3rd, Ferkey DM, Yost C, Pierce SB, Weaver C, Kimelman D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10684251", "url": "https://glygen.org/publication/PubMed/10684251" } ] }, { "title": "A superfamily of membrane-bound O-acyltransferases with implications for wnt signaling.", "journal": "Trends in biochemical sciences", "date": "2000", "authors": "Hofmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "10694878", "url": "https://glygen.org/publication/PubMed/10694878" } ] }, { "title": "GSK-3beta-dependent phosphorylation of adenomatous polyposis coli gene product can be modulated by beta-catenin and protein phosphatase 2A complexed with Axin.", "journal": "Oncogene", "date": "2000", "authors": "Ikeda S, Kishida M, Matsuura Y, Usui H, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "10698523", "url": "https://glygen.org/publication/PubMed/10698523" } ] }, { "title": "Dishevelled phosphorylation, subcellular localization and multimerization regulate its role in early embryogenesis.", "journal": "The EMBO journal", "date": "2000", "authors": "Rothbacher U, Laurent MN, Deardorff MA, Klein PS, Cho KW, Fraser SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "10698942", "url": "https://glygen.org/publication/PubMed/10698942" } ] }, { "title": "Role of frizzled 7 in the regulation of convergent extension movements during gastrulation in Xenopus laevis.", "journal": "Development (Cambridge, England)", "date": "2000", "authors": "Djiane A, Riou J, Umbhauer M, Boucaut J, Shi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "10862746", "url": "https://glygen.org/publication/PubMed/10862746" } ] }, { "title": "LDL-receptor-related proteins in Wnt signal transduction.", "journal": "Nature", "date": "2000", "authors": "Tamai K, Semenov M, Kato Y, Spokony R, Liu C, Katsuyama Y, Hess F, Saint-Jeannet JP, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "11029007", "url": "https://glygen.org/publication/PubMed/11029007" } ] }, { "title": "Secretory protein trafficking and organelle dynamics in living cells.", "journal": "Annual review of cell and developmental biology", "date": "2000", "authors": "Lippincott-Schwartz J, Roberts TH, Hirschberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "11031247", "url": "https://glygen.org/publication/PubMed/11031247" } ] }, { "title": "Activation of human peroxisome proliferator-activated receptor (PPAR) subtypes by pioglitazone.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Sakamoto J, Kimura H, Moriyama S, Odaka H, Momose Y, Sugiyama Y, Sawada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11095972", "url": "https://glygen.org/publication/PubMed/11095972" } ] }, { "title": "Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.", "journal": "Nature structural biology", "date": "2000", "authors": "Wong HC, Mao J, Nguyen JT, Srinivas S, Zhang W, Liu B, Li L, Wu D, Zheng J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "11101902", "url": "https://glygen.org/publication/PubMed/11101902" } ] }, { "title": "Membrane transport: retromer to the rescue.", "journal": "Current biology : CB", "date": "2001", "authors": "Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "11231171", "url": "https://glygen.org/publication/PubMed/11231171" } ] }, { "title": "Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lin HH, Stacey M, Saxby C, Knott V, Chaudhry Y, Evans D, Gordon S, McKnight AJ, Handford P, Lea S", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "11297558", "url": "https://glygen.org/publication/PubMed/11297558" } ] }, { "title": "Low-density lipoprotein receptor-related protein-5 binds to Axin and regulates the canonical Wnt signaling pathway.", "journal": "Molecular cell", "date": "2001", "authors": "Mao J, Wang J, Liu B, Pan W, Farr GH 3rd, Flynn C, Yuan H, Takada S, Kimelman D, Li L, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "11336703", "url": "https://glygen.org/publication/PubMed/11336703" } ] }, { "title": "LDL-receptor-related protein 6 is a receptor for Dickkopf proteins.", "journal": "Nature", "date": "2001", "authors": "Mao B, Wu W, Li Y, Hoppe D, Stannek P, Glinka A, Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "11357136", "url": "https://glygen.org/publication/PubMed/11357136" } ] }, { "title": "Unipolar membrane association of Dishevelled mediates Frizzled planar cell polarity signaling.", "journal": "Genes & development", "date": "2001", "authors": "Axelrod JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "11358862", "url": "https://glygen.org/publication/PubMed/11358862" } ] }, { "title": "SNX3 regulates endosomal function through its PX-domain-mediated interaction with PtdIns(3)P.", "journal": "Nature cell biology", "date": "2001", "authors": "Xu Y, Hortsman H, Seet L, Wong SH, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "11433298", "url": "https://glygen.org/publication/PubMed/11433298" } ] }, { "title": "Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.", "journal": "Current biology : CB", "date": "2001", "authors": "Semenov MV, Tamai K, Brott BK, Kuhl M, Sokol S, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "11448771", "url": "https://glygen.org/publication/PubMed/11448771" } ] }, { "title": "Armadillo nuclear import is regulated by cytoplasmic anchor Axin and nuclear anchor dTCF/Pan.", "journal": "Development (Cambridge, England)", "date": "2001", "authors": "Tolwinski NS, Wieschaus E", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "11493532", "url": "https://glygen.org/publication/PubMed/11493532" } ] }, { "title": "Identification of the Axin and Frat binding region of glycogen synthase kinase-3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fraser E, Young N, Dajani R, Franca-Koh J, Ryves J, Williams RS, Yeo M, Webster MT, Richardson C, Smalley MJ, Pearl LH, Harwood A, Dale TC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "11707456", "url": "https://glygen.org/publication/PubMed/11707456" } ] }, { "title": "The structure of phosphorylated GSK-3beta complexed with a peptide, FRATtide, that inhibits beta-catenin phosphorylation.", "journal": "Structure (London, England : 1993)", "date": "2001", "authors": "Bax B, Carter PS, Lewis C, Guy AR, Bridges A, Tanner R, Pettman G, Mannix C, Culbert AA, Brown MJ, Smith DG, Reith AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "11738041", "url": "https://glygen.org/publication/PubMed/11738041" } ] }, { "title": "JNK functions in the non-canonical Wnt pathway to regulate convergent extension movements in vertebrates.", "journal": "EMBO reports", "date": "2002", "authors": "Yamanaka H, Moriguchi T, Masuyama N, Kusakabe M, Hanafusa H, Takada R, Takada S, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "11751577", "url": "https://glygen.org/publication/PubMed/11751577" } ] }, { "title": "Wnt/Frizzled activation of Rho regulates vertebrate gastrulation and requires a novel Formin homology protein Daam1.", "journal": "Cell", "date": "2001", "authors": "Habas R, Kato Y, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "11779461", "url": "https://glygen.org/publication/PubMed/11779461" } ] }, { "title": "Glycogen synthase kinase-3 beta mutagenesis identifies a common binding domain for GBP and Axin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ferkey DM, Kimelman D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "11861647", "url": "https://glygen.org/publication/PubMed/11861647" } ] }, { "title": "Regional differences in the response of human pre-adipocytes to PPARgamma and RXRalpha agonists.", "journal": "Diabetes", "date": "2002", "authors": "Sewter CP, Blows F, Vidal-Puig A, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "11872672", "url": "https://glygen.org/publication/PubMed/11872672" } ] }, { "title": "Prickle mediates feedback amplification to generate asymmetric planar cell polarity signaling.", "journal": "Cell", "date": "2002", "authors": "Tree DR, Shulman JM, Rousset R, Scott MP, Gubb D, Axelrod JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "12015986", "url": "https://glygen.org/publication/PubMed/12015986" } ] }, { "title": "Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Hansen IA, Jakob O, Wortmann S, Arzberger T, Allolio B, Blind E", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "12098667", "url": "https://glygen.org/publication/PubMed/12098667" } ] }, { "title": "An actin nucleation mechanism mediated by Bni1 and profilin.", "journal": "Nature cell biology", "date": "2002", "authors": "Sagot I, Rodal AA, Moseley J, Goode BL, Pellman D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "12134165", "url": "https://glygen.org/publication/PubMed/12134165" } ] }, { "title": "Ligand receptor interactions in the Wnt signaling pathway in Drosophila.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wu CH, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "12205098", "url": "https://glygen.org/publication/PubMed/12205098" } ] }, { "title": "Leptin gene expression in human preadipocytes is switched on by maturation-induced demethylation of distinct CpGs in its proximal promoter.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Melzner I, Scott V, Dorsch K, Fischer P, Wabitsch M, Bruderlein S, Hasel C, Moller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12213831", "url": "https://glygen.org/publication/PubMed/12213831" } ] }, { "title": "The ins and outs of APC and beta-catenin nuclear transport.", "journal": "EMBO reports", "date": "2002", "authors": "Henderson BR, Fagotto F", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "12223464", "url": "https://glygen.org/publication/PubMed/12223464" } ] }, { "title": "Coactivation of Rac and Rho by Wnt/Frizzled signaling is required for vertebrate gastrulation.", "journal": "Genes & development", "date": "2003", "authors": "Habas R, Dawid IB, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "12533515", "url": "https://glygen.org/publication/PubMed/12533515" } ] }, { "title": "Structural basis for recruitment of glycogen synthase kinase 3beta to the axin-APC scaffold complex.", "journal": "The EMBO journal", "date": "2003", "authors": "Dajani R, Fraser E, Roe SM, Yeo M, Good VM, Thompson V, Dale TC, Pearl LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "12554650", "url": "https://glygen.org/publication/PubMed/12554650" } ] }, { "title": "Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor.", "journal": "Neuropharmacology", "date": "2003", "authors": "Della Penna K, Kinose F, Sun H, Koblan KS, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "12559132", "url": "https://glygen.org/publication/PubMed/12559132" } ] }, { "title": "Wnt proteins are lipid-modified and can act as stem cell growth factors.", "journal": "Nature", "date": "2003", "authors": "Willert K, Brown JD, Danenberg E, Duncan AW, Weissman IL, Reya T, Yates JR 3rd, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "12717451", "url": "https://glygen.org/publication/PubMed/12717451" } ] }, { "title": "Induction of adiponectin, a fat-derived antidiabetic and antiatherogenic factor, by nuclear receptors.", "journal": "Diabetes", "date": "2003", "authors": "Iwaki M, Matsuda M, Maeda N, Funahashi T, Matsuzawa Y, Makishima M, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "12829629", "url": "https://glygen.org/publication/PubMed/12829629" } ] }, { "title": "The receptor tyrosine kinase Ror2 is involved in non-canonical Wnt5a/JNK signalling pathway.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2003", "authors": "Oishi I, Suzuki H, Onishi N, Takada R, Kani S, Ohkawara B, Koshida I, Suzuki K, Yamada G, Schwabe GC, Mundlos S, Shibuya H, Takada S, Minami Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "12839624", "url": "https://glygen.org/publication/PubMed/12839624" } ] }, { "title": "Direct binding of the PDZ domain of Dishevelled to a conserved internal sequence in the C-terminal region of Frizzled.", "journal": "Molecular cell", "date": "2003", "authors": "Wong HC, Bourdelas A, Krauss A, Lee HJ, Shao Y, Wu D, Mlodzik M, Shi DL, Zheng J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "14636582", "url": "https://glygen.org/publication/PubMed/14636582" } ] }, { "title": "A mechanism for Wnt coreceptor activation.", "journal": "Molecular cell", "date": "2004", "authors": "Tamai K, Zeng X, Liu C, Zhang X, Harada Y, Chang Z, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "14731402", "url": "https://glygen.org/publication/PubMed/14731402" } ] }, { "title": "Nuclear-cytoplasmic shuttling of Axin regulates subcellular localization of beta-catenin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Cong F, Varmus H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "14981260", "url": "https://glygen.org/publication/PubMed/14981260" } ] }, { "title": "Characterization and functional analysis of the murine Frat2 gene.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "van Amerongen R, van der Gulden H, Bleeker F, Jonkers J, Berns A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "15073180", "url": "https://glygen.org/publication/PubMed/15073180" } ] }, { "title": "LDL receptor-related proteins 5 and 6 in Wnt/beta-catenin signaling: arrows point the way.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "He X, Semenov M, Tamai K, Zeng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "15084453", "url": "https://glygen.org/publication/PubMed/15084453" } ] }, { "title": "Wnt proteins induce dishevelled phosphorylation via an LRP5/6- independent mechanism, irrespective of their ability to stabilize beta-catenin.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Gonzalez-Sancho JM, Brennan KR, Castelo-Soccio LA, Brown AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "15143170", "url": "https://glygen.org/publication/PubMed/15143170" } ] }, { "title": "Frizzled6 controls hair patterning in mice.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Guo N, Hawkins C, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "15169958", "url": "https://glygen.org/publication/PubMed/15169958" } ] }, { "title": "Pygopus and Legless target Armadillo/beta-catenin to the nucleus to enable its transcriptional co-activator function.", "journal": "Nature cell biology", "date": "2004", "authors": "Townsley FM, Cliffe A, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "15208637", "url": "https://glygen.org/publication/PubMed/15208637" } ] }, { "title": "Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2004", "authors": "Rival Y, Stennevin A, Puech L, Rouquette A, Cathala C, Lestienne F, Dupont-Passelaigue E, Patoiseau JF, Wurch T, Junquero D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15273253", "url": "https://glygen.org/publication/PubMed/15273253" } ] }, { "title": "Mammalian Ryk is a Wnt coreceptor required for stimulation of neurite outgrowth.", "journal": "Cell", "date": "2004", "authors": "Lu W, Yamamoto V, Ortega B, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "15454084", "url": "https://glygen.org/publication/PubMed/15454084" } ] }, { "title": "Wnt signals across the plasma membrane to activate the beta-catenin pathway by forming oligomers containing its receptors, Frizzled and LRP.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Cong F, Schweizer L, Varmus H", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "15459103", "url": "https://glygen.org/publication/PubMed/15459103" } ] }, { "title": "Expression of the largest CD97 and EMR2 isoforms on leukocytes facilitates a specific interaction with chondroitin sulfate on B cells.", "journal": "Journal of leukocyte biology", "date": "2005", "authors": "Kwakkenbos MJ, Pouwels W, Matmati M, Stacey M, Lin HH, Gordon S, van Lier RA, Hamann J", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "15498814", "url": "https://glygen.org/publication/PubMed/15498814" } ] }, { "title": "Formins: processive cappers of growing actin filaments.", "journal": "Experimental cell research", "date": "2004", "authors": "Watanabe N, Higashida C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "15501440", "url": "https://glygen.org/publication/PubMed/15501440" } ] }, { "title": "Wnt signaling through Dishevelled, Rac and JNK regulates dendritic development.", "journal": "Nature neuroscience", "date": "2005", "authors": "Rosso SB, Sussman D, Wynshaw-Boris A, Salinas PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "15608632", "url": "https://glygen.org/publication/PubMed/15608632" } ] }, { "title": "Frat is dispensable for canonical Wnt signaling in mammals.", "journal": "Genes & development", "date": "2005", "authors": "van Amerongen R, Nawijn M, Franca-Koh J, Zevenhoven J, van der Gulden H, Jonkers J, Berns A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "15681612", "url": "https://glygen.org/publication/PubMed/15681612" } ] }, { "title": "Identification of the promoter region required for human adiponectin gene transcription: Association with CCAAT/enhancer binding protein-beta and tumor necrosis factor-alpha.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kita A, Yamasaki H, Kuwahara H, Moriuchi A, Fukushima K, Kobayashi M, Fukushima T, Takahashi R, Abiru N, Uotani S, Kawasaki E, Eguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15850785", "url": "https://glygen.org/publication/PubMed/15850785" } ] }, { "title": "C/EBPalpha regulates human adiponectin gene transcription through an intronic enhancer.", "journal": "Diabetes", "date": "2005", "authors": "Qiao L, Maclean PS, Schaack J, Orlicky DJ, Darimont C, Pagliassotti M, Friedman JE, Shao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "15919796", "url": "https://glygen.org/publication/PubMed/15919796" } ] }, { "title": "Subcellular localization and signaling properties of dishevelled in developing vertebrate embryos.", "journal": "Current biology : CB", "date": "2005", "authors": "Park TJ, Gray RS, Sato A, Habas R, Wallingford JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "15936275", "url": "https://glygen.org/publication/PubMed/15936275" } ] }, { "title": "Re-evaluating the role of Frat in Wnt-signal transduction.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2005", "authors": "van Amerongen R, Berns A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "16082208", "url": "https://glygen.org/publication/PubMed/16082208" } ] }, { "title": "Ryk-mediated Wnt repulsion regulates posterior-directed growth of corticospinal tract.", "journal": "Nature neuroscience", "date": "2005", "authors": "Liu Y, Shi J, Lu CC, Wang ZB, Lyuksyutova AI, Song XJ, Zou Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16116452", "url": "https://glygen.org/publication/PubMed/16116452" } ] }, { "title": "Wnt-Ryk signalling mediates medial-lateral retinotectal topographic mapping.", "journal": "Nature", "date": "2006", "authors": "Schmitt AM, Shi J, Wolf AM, Lu CC, King LA, Zou Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16280981", "url": "https://glygen.org/publication/PubMed/16280981" } ] }, { "title": "Casein kinase 1 gamma couples Wnt receptor activation to cytoplasmic signal transduction.", "journal": "Nature", "date": "2005", "authors": "Davidson G, Wu W, Shen J, Bilic J, Fenger U, Stannek P, Glinka A, Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "16341016", "url": "https://glygen.org/publication/PubMed/16341016" } ] }, { "title": "A dual-kinase mechanism for Wnt co-receptor phosphorylation and activation.", "journal": "Nature", "date": "2005", "authors": "Zeng X, Tamai K, Doble B, Li S, Huang H, Habas R, Okamura H, Woodgett J, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "16341017", "url": "https://glygen.org/publication/PubMed/16341017" } ] }, { "title": "Release and trafficking of lipid-linked morphogens.", "journal": "Current opinion in genetics & development", "date": "2006", "authors": "Eaton S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "16364628", "url": "https://glygen.org/publication/PubMed/16364628" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "The role of Frizzled3 and Frizzled6 in neural tube closure and in the planar polarity of inner-ear sensory hair cells.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Wang Y, Guo N, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16495441", "url": "https://glygen.org/publication/PubMed/16495441" } ] }, { "title": "Nucleo-cytoplasmic distribution of beta-catenin is regulated by retention.", "journal": "Journal of cell science", "date": "2006", "authors": "Krieghoff E, Behrens J, Mayr B", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "16554443", "url": "https://glygen.org/publication/PubMed/16554443" } ] }, { "title": "Purified Wnt5a protein activates or inhibits beta-catenin-TCF signaling depending on receptor context.", "journal": "PLoS biology", "date": "2006", "authors": "Mikels AJ, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16602827", "url": "https://glygen.org/publication/PubMed/16602827" } ] }, { "title": "Wnt gradient formation requires retromer function in Wnt-producing cells.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Coudreuse DY, Roel G, Betist MC, Destree O, Korswagen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "16645052", "url": "https://glygen.org/publication/PubMed/16645052" } ] }, { "title": "Wntless, a conserved membrane protein dedicated to the secretion of Wnt proteins from signaling cells.", "journal": "Cell", "date": "2006", "authors": "Banziger C, Soldini D, Schutt C, Zipperlen P, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "16678095", "url": "https://glygen.org/publication/PubMed/16678095" } ] }, { "title": "Secretion of Wnt ligands requires Evi, a conserved transmembrane protein.", "journal": "Cell", "date": "2006", "authors": "Bartscherer K, Pelte N, Ingelfinger D, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "16678096", "url": "https://glygen.org/publication/PubMed/16678096" } ] }, { "title": "The Wnt receptor Ryk is required for Wnt5a-mediated axon guidance on the contralateral side of the corpus callosum.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Keeble TR, Halford MM, Seaman C, Kee N, Macheda M, Anderson RB, Stacker SA, Cooper HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16723543", "url": "https://glygen.org/publication/PubMed/16723543" } ] }, { "title": "Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.", "journal": "Developmental cell", "date": "2006", "authors": "Yamamoto H, Komekado H, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "16890161", "url": "https://glygen.org/publication/PubMed/16890161" } ] }, { "title": "Ryk: a novel Wnt receptor regulating axon pathfinding.", "journal": "The international journal of biochemistry & cell biology", "date": "2006", "authors": "Keeble TR, Cooper HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "16971168", "url": "https://glygen.org/publication/PubMed/16971168" } ] }, { "title": "Transcriptional control of adipocyte formation.", "journal": "Cell metabolism", "date": "2006", "authors": "Farmer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17011499", "url": "https://glygen.org/publication/PubMed/17011499" } ] }, { "title": "Profilin is an effector for Daam1 in non-canonical Wnt signaling and is required for vertebrate gastrulation.", "journal": "Development (Cambridge, England)", "date": "2006", "authors": "Sato A, Khadka DK, Liu W, Bharti R, Runnels LW, Dawid IB, Habas R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "17021034", "url": "https://glygen.org/publication/PubMed/17021034" } ] }, { "title": "Sprinter: a novel transmembrane protein required for Wg secretion and signaling.", "journal": "Development (Cambridge, England)", "date": "2006", "authors": "Goodman RM, Thombre S, Firtina Z, Gray D, Betts D, Roebuck J, Spana EP, Selva EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "17108000", "url": "https://glygen.org/publication/PubMed/17108000" } ] }, { "title": "Post-translational palmitoylation and glycosylation of Wnt-5a are necessary for its signalling.", "journal": "The Biochemical journal", "date": "2007", "authors": "Kurayoshi M, Yamamoto H, Izumi S, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "17117926", "url": "https://glygen.org/publication/PubMed/17117926" } ] }, { "title": "Wnt11 controls cell contact persistence by local accumulation of Frizzled 7 at the plasma membrane.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Witzel S, Zimyanin V, Carreira-Barbosa F, Tada M, Heisenberg CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "17130287", "url": "https://glygen.org/publication/PubMed/17130287" } ] }, { "title": "Monounsaturated fatty acid modification of Wnt protein: its role in Wnt secretion.", "journal": "Developmental cell", "date": "2006", "authors": "Takada R, Satomi Y, Kurata T, Ueno N, Norioka S, Kondoh H, Takao T, Takada S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "17141155", "url": "https://glygen.org/publication/PubMed/17141155" } ] }, { "title": "beta-catenin destruction complex: insights and questions from a structural perspective.", "journal": "Oncogene", "date": "2006", "authors": "Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "17143292", "url": "https://glygen.org/publication/PubMed/17143292" } ] }, { "title": "An antagonist of dishevelled protein-protein interaction suppresses beta-catenin-dependent tumor cell growth.", "journal": "Cancer research", "date": "2007", "authors": "Fujii N, You L, Xu Z, Uematsu K, Shan J, He B, Mikami I, Edmondson LR, Neale G, Zheng J, Guy RK, Jablons DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "17234765", "url": "https://glygen.org/publication/PubMed/17234765" } ] }, { "title": "Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.", "journal": "The EMBO journal", "date": "2007", "authors": "Luo W, Peterson A, Garcia BA, Coombs G, Kofahl B, Heinrich R, Shabanowitz J, Hunt DF, Yost HJ, Virshup DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "17318175", "url": "https://glygen.org/publication/PubMed/17318175" } ] }, { "title": "Mechanism and function of formins in the control of actin assembly.", "journal": "Annual review of biochemistry", "date": "2007", "authors": "Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "17373907", "url": "https://glygen.org/publication/PubMed/17373907" } ] }, { "title": "Glycosylation and palmitoylation of Wnt-3a are coupled to produce an active form of Wnt-3a.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2007", "authors": "Komekado H, Yamamoto H, Chiba T, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "17397399", "url": "https://glygen.org/publication/PubMed/17397399" } ] }, { "title": "Wnt5a functions in planar cell polarity regulation in mice.", "journal": "Developmental biology", "date": "2007", "authors": "Qian D, Jones C, Rzadzinska A, Mark S, Zhang X, Steel KP, Dai X, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "17433286", "url": "https://glygen.org/publication/PubMed/17433286" } ] }, { "title": "The DIX domain of Dishevelled confers Wnt signaling by dynamic polymerization.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Schwarz-Romond T, Fiedler M, Shibata N, Butler PJ, Kikuchi A, Higuchi Y, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "17529994", "url": "https://glygen.org/publication/PubMed/17529994" } ] }, { "title": "Wnt induces LRP6 signalosomes and promotes dishevelled-dependent LRP6 phosphorylation.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Bilic J, Huang YL, Davidson G, Zimmermann T, Cruciat CM, Bienz M, Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "17569865", "url": "https://glygen.org/publication/PubMed/17569865" } ] }, { "title": "XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway.", "journal": "The EMBO journal", "date": "2007", "authors": "Lee RH, Iioka H, Ohashi M, Iemura S, Natsume T, Kinoshita N", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "17627283", "url": "https://glygen.org/publication/PubMed/17627283" } ] }, { "title": "Effect of heterodimer partner RXRalpha on PPARgamma activation function-2 helix in solution.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Lu J, Chen M, Stanley SE, Li E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "17980149", "url": "https://glygen.org/publication/PubMed/17980149" } ] }, { "title": "Initiation of Wnt signaling: control of Wnt coreceptor Lrp6 phosphorylation/activation via frizzled, dishevelled and axin functions.", "journal": "Development (Cambridge, England)", "date": "2008", "authors": "Zeng X, Huang H, Tamai K, Zhang X, Harada Y, Yokota C, Almeida K, Wang J, Doble B, Woodgett J, Wynshaw-Boris A, Hsieh JC, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "18077588", "url": "https://glygen.org/publication/PubMed/18077588" } ] }, { "title": "Wnt signaling requires retromer-dependent recycling of MIG-14/Wntless in Wnt-producing cells.", "journal": "Developmental cell", "date": "2008", "authors": "Yang PT, Lorenowicz MJ, Silhankova M, Coudreuse DY, Betist MC, Korswagen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "18160347", "url": "https://glygen.org/publication/PubMed/18160347" } ] }, { "title": "The retromer complex influences Wnt secretion by recycling wntless from endosomes to the trans-Golgi network.", "journal": "Developmental cell", "date": "2008", "authors": "Belenkaya TY, Wu Y, Tang X, Zhou B, Cheng L, Sharma YV, Yan D, Selva EM, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "18160348", "url": "https://glygen.org/publication/PubMed/18160348" } ] }, { "title": "Mechanism of activation of the Formin protein Daam1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Liu W, Sato A, Khadka D, Bharti R, Diaz H, Runnels LW, Habas R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "18162551", "url": "https://glygen.org/publication/PubMed/18162551" } ] }, { "title": "Wingless secretion promotes and requires retromer-dependent cycling of Wntless.", "journal": "Nature cell biology", "date": "2008", "authors": "Port F, Kuster M, Herr P, Furger E, Banziger C, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "18193032", "url": "https://glygen.org/publication/PubMed/18193032" } ] }, { "title": "Wingless secretion requires endosome-to-Golgi retrieval of Wntless/Evi/Sprinter by the retromer complex.", "journal": "Nature cell biology", "date": "2008", "authors": "Franch-Marro X, Wendler F, Guidato S, Griffith J, Baena-Lopez A, Itasaki N, Maurice MM, Vincent JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "18193037", "url": "https://glygen.org/publication/PubMed/18193037" } ] }, { "title": "Ror2 modulates the canonical Wnt signaling in lung epithelial cells through cooperation with Fzd2.", "journal": "BMC molecular biology", "date": "2008", "authors": "Li C, Chen H, Hu L, Xing Y, Sasaki T, Villosis MF, Li J, Nishita M, Minami Y, Minoo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "18215320", "url": "https://glygen.org/publication/PubMed/18215320" } ] }, { "title": "WGEF activates Rho in the Wnt-PCP pathway and controls convergent extension in Xenopus gastrulation.", "journal": "The EMBO journal", "date": "2008", "authors": "Tanegashima K, Zhao H, Dawid IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "18256687", "url": "https://glygen.org/publication/PubMed/18256687" } ] }, { "title": "Wnt/beta-catenin signaling: new (and old) players and new insights.", "journal": "Current opinion in cell biology", "date": "2008", "authors": "Huang H, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "18339531", "url": "https://glygen.org/publication/PubMed/18339531" } ] }, { "title": "Wnt signal amplification via activity, cooperativity, and regulation of multiple intracellular PPPSP motifs in the Wnt co-receptor LRP6.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "MacDonald BT, Yokota C, Tamai K, Zeng X, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "18362152", "url": "https://glygen.org/publication/PubMed/18362152" } ] }, { "title": "Rac1 activation controls nuclear localization of beta-catenin during canonical Wnt signaling.", "journal": "Cell", "date": "2008", "authors": "Wu X, Tu X, Joeng KS, Hilton MJ, Williams DA, Long F", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "18423204", "url": "https://glygen.org/publication/PubMed/18423204" } ] }, { "title": "Lipid-independent secretion of a Drosophila Wnt protein.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ching W, Hang HC, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "18430724", "url": "https://glygen.org/publication/PubMed/18430724" } ] }, { "title": "Wnt3a and Dkk1 regulate distinct internalization pathways of LRP6 to tune the activation of beta-catenin signaling.", "journal": "Developmental cell", "date": "2008", "authors": "Yamamoto H, Sakane H, Yamamoto H, Michiue T, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "18606139", "url": "https://glygen.org/publication/PubMed/18606139" } ] }, { "title": "Mammalian Rho GTPases: new insights into their functions from in vivo studies.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Heasman SJ, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "18719708", "url": "https://glygen.org/publication/PubMed/18719708" } ] }, { "title": "Profilin, a multi-modal regulator of neuronal plasticity.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2008", "authors": "Birbach A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "18798527", "url": "https://glygen.org/publication/PubMed/18798527" } ] }, { "title": "Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Pioszak AA, Parker NR, Suino-Powell K, Xu HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "18801728", "url": "https://glygen.org/publication/PubMed/18801728" } ] }, { "title": "Identification of a novel distal enhancer in human adiponectin gene.", "journal": "The Journal of endocrinology", "date": "2009", "authors": "Segawa K, Matsuda M, Fukuhara A, Morita K, Okuno Y, Komuro R, Shimomura I", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "18931025", "url": "https://glygen.org/publication/PubMed/18931025" } ] }, { "title": "Cleavage of the Wnt receptor Ryk regulates neuronal differentiation during cortical neurogenesis.", "journal": "Developmental cell", "date": "2008", "authors": "Lyu J, Yamamoto V, Lu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "19000841", "url": "https://glygen.org/publication/PubMed/19000841" } ] }, { "title": "Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.", "journal": "Nature", "date": "2008", "authors": "Chandra V, Huang P, Hamuro Y, Raghuram S, Wang Y, Burris TP, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19043829", "url": "https://glygen.org/publication/PubMed/19043829" } ] }, { "title": "APC is essential for targeting phosphorylated beta-catenin to the SCFbeta-TrCP ubiquitin ligase.", "journal": "Molecular cell", "date": "2008", "authors": "Su Y, Fu C, Ishikawa S, Stella A, Kojima M, Shitoh K, Schreiber EM, Day BW, Liu B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "19061640", "url": "https://glygen.org/publication/PubMed/19061640" } ] }, { "title": "Direct inhibition of GSK3beta by the phosphorylated cytoplasmic domain of LRP6 in Wnt/beta-catenin signaling.", "journal": "PloS one", "date": "2008", "authors": "Piao S, Lee SH, Kim H, Yum S, Stamos JL, Xu Y, Lee SJ, Lee J, Oh S, Han JK, Park BJ, Weis WI, Ha NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "19107203", "url": "https://glygen.org/publication/PubMed/19107203" } ] }, { "title": "A-FABP, a candidate progression marker of human transitional cell carcinoma of the bladder, is differentially regulated by PPAR in urothelial cancer cells.", "journal": "International journal of cancer", "date": "2009", "authors": "Boiteux G, Lascombe I, Roche E, Plissonnier ML, Clairotte A, Bittard H, Fauconnet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19115207", "url": "https://glygen.org/publication/PubMed/19115207" } ] }, { "title": "Structural basis for the activation of PPARgamma by oxidized fatty acids.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Itoh T, Fairall L, Amin K, Inaba Y, Szanto A, Balint BL, Nagy L, Yamamoto K, Schwabe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "19172745", "url": "https://glygen.org/publication/PubMed/19172745" } ] }, { "title": "Wnt/Fz signaling and the cytoskeleton: potential roles in tumorigenesis.", "journal": "Cell research", "date": "2009", "authors": "Lai SL, Chien AJ, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "19365405", "url": "https://glygen.org/publication/PubMed/19365405" } ] }, { "title": "Exosomes--vesicular carriers for intercellular communication.", "journal": "Current opinion in cell biology", "date": "2009", "authors": "Simons M, Raposo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "19442504", "url": "https://glygen.org/publication/PubMed/19442504" } ] }, { "title": "Non-redundant roles for Profilin2 and Profilin1 during vertebrate gastrulation.", "journal": "Developmental biology", "date": "2009", "authors": "Khadka DK, Liu W, Habas R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "19523939", "url": "https://glygen.org/publication/PubMed/19523939" } ] }, { "title": "Ror-family receptor tyrosine kinases in noncanonical Wnt signaling: their implications in developmental morphogenesis and human diseases.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2010", "authors": "Minami Y, Oishi I, Endo M, Nishita M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "19530173", "url": "https://glygen.org/publication/PubMed/19530173" } ] }, { "title": "The p24 family and selective transport processes at the ER-Golgi interface.", "journal": "Biology of the cell", "date": "2009", "authors": "Strating JR, Martens GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "19566487", "url": "https://glygen.org/publication/PubMed/19566487" } ] }, { "title": "Formin-binding proteins: modulators of formin-dependent actin polymerization.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "19589360", "url": "https://glygen.org/publication/PubMed/19589360" } ] }, { "title": "Wnt/beta-catenin signaling: components, mechanisms, and diseases.", "journal": "Developmental cell", "date": "2009", "authors": "MacDonald BT, Tamai K, He X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "19619488", "url": "https://glygen.org/publication/PubMed/19619488" } ] }, { "title": "Frat oncoproteins act at the crossroad of canonical and noncanonical Wnt-signaling pathways.", "journal": "Oncogene", "date": "2010", "authors": "van Amerongen R, Nawijn MC, Lambooij JP, Proost N, Jonkers J, Berns A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "19802005", "url": "https://glygen.org/publication/PubMed/19802005" } ] }, { "title": "Trans-synaptic transmission of vesicular Wnt signals through Evi/Wntless.", "journal": "Cell", "date": "2009", "authors": "Korkut C, Ataman B, Ramachandran P, Ashley J, Barria R, Gherbesi N, Budnik V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "19837038", "url": "https://glygen.org/publication/PubMed/19837038" } ] }, { "title": "Ryks: new partners for Wnts in the developing and regenerating nervous system.", "journal": "Trends in neurosciences", "date": "2010", "authors": "Fradkin LG, Dura JM, Noordermeer JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "20004982", "url": "https://glygen.org/publication/PubMed/20004982" } ] }, { "title": "Dishevelled: The hub of Wnt signaling.", "journal": "Cellular signalling", "date": "2010", "authors": "Gao C, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "20006983", "url": "https://glygen.org/publication/PubMed/20006983" } ] }, { "title": "Human fetal mesenchymal stem cells differentiate into brown and white adipocytes: a role for ERRalpha in human UCP1 expression.", "journal": "Cell research", "date": "2010", "authors": "Morganstein DL, Wu P, Mane MR, Fisk NM, White R, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "20101261", "url": "https://glygen.org/publication/PubMed/20101261" } ] }, { "title": "Wnt trafficking: new insights into Wnt maturation, secretion and spreading.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Port F, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "20477987", "url": "https://glygen.org/publication/PubMed/20477987" } ] }, { "title": "Protein sorting receptors in the early secretory pathway.", "journal": "Annual review of biochemistry", "date": "2010", "authors": "Dancourt J, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "20533886", "url": "https://glygen.org/publication/PubMed/20533886" } ] }, { "title": "Rho-kinase/ROCK: A key regulator of the cytoskeleton and cell polarity.", "journal": "Cytoskeleton (Hoboken, N.J.)", "date": "2010", "authors": "Amano M, Nakayama M, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "20803696", "url": "https://glygen.org/publication/PubMed/20803696" } ] }, { "title": "WLS-dependent secretion of WNT3A requires Ser209 acylation and vacuolar acidification.", "journal": "Journal of cell science", "date": "2010", "authors": "Coombs GS, Yu J, Canning CA, Veltri CA, Covey TM, Cheong JK, Utomo V, Banerjee N, Zhang ZH, Jadulco RC, Concepcion GP, Bugni TS, Harper MK, Mihalek I, Jones CM, Ireland CM, Virshup DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "20826466", "url": "https://glygen.org/publication/PubMed/20826466" } ] }, { "title": "Frizzled 1 and frizzled 2 genes function in palate, ventricular septum and neural tube closure: general implications for tissue fusion processes.", "journal": "Development (Cambridge, England)", "date": "2010", "authors": "Yu H, Smallwood PM, Wang Y, Vidaltamayo R, Reed R, Nathans J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "20940229", "url": "https://glygen.org/publication/PubMed/20940229" } ] }, { "title": "Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Pal K, Swaminathan K, Xu HE, Pioszak AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "20966082", "url": "https://glygen.org/publication/PubMed/20966082" } ] }, { "title": "Wnt signaling: multivesicular bodies hold GSK3 captive.", "journal": "Cell", "date": "2010", "authors": "Niehrs C, Acebron SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "21183070", "url": "https://glygen.org/publication/PubMed/21183070" } ] }, { "title": "Wnt signaling requires sequestration of glycogen synthase kinase 3 inside multivesicular endosomes.", "journal": "Cell", "date": "2010", "authors": "Taelman VF, Dobrowolski R, Plouhinec JL, Fuentealba LC, Vorwald PP, Gumper I, Sabatini DD, De Robertis EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "21183076", "url": "https://glygen.org/publication/PubMed/21183076" } ] }, { "title": "Fatty acid modification of Wnt1 and Wnt3a at serine is prerequisite for lipidation at cysteine and is essential for Wnt signalling.", "journal": "Cell. Signal.", "date": "2011", "authors": "Doubravska L, Krausova M, Gradl D, Vojtechova M, Tumova L, Lukas J, Valenta T, Pospichalova V, Fafilek B, Plachy J, Sebesta O, Korinek V", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "21244856", "url": "https://glygen.org/publication/PubMed/21244856" } ] }, { "title": "Membrane trafficking: a GSK3 lockdown.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "Schuldt A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "21252990", "url": "https://glygen.org/publication/PubMed/21252990" } ] }, { "title": "Wnt signaling gradients establish planar cell polarity by inducing Vangl2 phosphorylation through Ror2.", "journal": "Developmental cell", "date": "2011", "authors": "Gao B, Song H, Bishop K, Elliot G, Garrett L, English MA, Andre P, Robinson J, Sood R, Minami Y, Economides AN, Yang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "21316585", "url": "https://glygen.org/publication/PubMed/21316585" } ] }, { "title": "The ubiquitin-specific protease USP34 regulates axin stability and Wnt/beta-catenin signaling.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Lui TT, Lacroix C, Ahmed SM, Goldenberg SJ, Leach CA, Daulat AM, Angers S", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "21383061", "url": "https://glygen.org/publication/PubMed/21383061" } ] }, { "title": "Porcupine homolog is required for canonical Wnt signaling and gastrulation in mouse embryos.", "journal": "Developmental biology", "date": "2011", "authors": "Biechele S, Cox BJ, Rossant J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "21554866", "url": "https://glygen.org/publication/PubMed/21554866" } ] }, { "title": "The SNXy flavours of endosomal sorting.", "journal": "Nature cell biology", "date": "2011", "authors": "Johannes L, Wunder C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "21725318", "url": "https://glygen.org/publication/PubMed/21725318" } ] }, { "title": "A SNX3-dependent retromer pathway mediates retrograde transport of the Wnt sorting receptor Wntless and is required for Wnt secretion.", "journal": "Nature cell biology", "date": "2011", "authors": "Harterink M, Port F, Lorenowicz MJ, McGough IJ, Silhankova M, Betist MC, van Weering JRT, van Heesbeen RGHP, Middelkoop TC, Basler K, Cullen PJ, Korswagen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "21725319", "url": "https://glygen.org/publication/PubMed/21725319" } ] }, { "title": "Deletion of mouse Porcn blocks Wnt ligand secretion and reveals an ectodermal etiology of human focal dermal hypoplasia/Goltz syndrome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Barrott JJ, Cash GM, Smith AP, Barrow JR, Murtaugh LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "21768372", "url": "https://glygen.org/publication/PubMed/21768372" } ] }, { "title": "Mindbomb 1, an E3 ubiquitin ligase, forms a complex with RYK to activate Wnt/beta-catenin signaling.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Berndt JD, Aoyagi A, Yang P, Anastas JN, Tang L, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "21875946", "url": "https://glygen.org/publication/PubMed/21875946" } ] }, { "title": "A genome-wide RNA interference screen uncovers two p24 proteins as regulators of Wingless secretion.", "journal": "EMBO reports", "date": "2011", "authors": "Port F, Hausmann G, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "21886182", "url": "https://glygen.org/publication/PubMed/21886182" } ] }, { "title": "Structural basis of Wnt signaling inhibition by Dickkopf binding to LRP5/6.", "journal": "Developmental cell", "date": "2011", "authors": "Ahn VE, Chu ML, Choi HJ, Tran D, Abo A, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "22000856", "url": "https://glygen.org/publication/PubMed/22000856" } ] }, { "title": "FoxM1 promotes beta-catenin nuclear localization and controls Wnt target-gene expression and glioma tumorigenesis.", "journal": "Cancer cell", "date": "2011", "authors": "Zhang N, Wei P, Gong A, Chiu WT, Lee HT, Colman H, Huang H, Xue J, Liu M, Wang Y, Sawaya R, Xie K, Yung WK, Medema RH, He X, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "22014570", "url": "https://glygen.org/publication/PubMed/22014570" } ] }, { "title": "Identification of an endocytosis motif in an intracellular loop of Wntless protein, essential for its recycling and the control of Wnt protein signaling.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Gasnereau I, Herr P, Chia PZ, Basler K, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22027831", "url": "https://glygen.org/publication/PubMed/22027831" } ] }, { "title": "SNX3 controls Wingless/Wnt secretion through regulating retromer-dependent recycling of Wntless.", "journal": "Cell research", "date": "2011", "authors": "Zhang P, Wu Y, Belenkaya TY, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22041890", "url": "https://glygen.org/publication/PubMed/22041890" } ] }, { "title": "Differential palmit(e)oylation of Wnt1 on C93 and S224 residues has overlapping and distinct consequences.", "journal": "PloS one", "date": "2011", "authors": "Galli LM, Burrus LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22046319", "url": "https://glygen.org/publication/PubMed/22046319" } ] }, { "title": "p24 proteins are required for secretion of Wnt ligands.", "journal": "EMBO reports", "date": "2011", "authors": "Buechling T, Chaudhary V, Spirohn K, Weiss M, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22094269", "url": "https://glygen.org/publication/PubMed/22094269" } ] }, { "title": "Wnts need a p(assport)24 to leave the ER.", "journal": "EMBO reports", "date": "2011", "authors": "Palmer L, Vincent JP, Beckett K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22094272", "url": "https://glygen.org/publication/PubMed/22094272" } ] }, { "title": "Porcupine-mediated lipidation is required for Wnt recognition by Wls.", "journal": "Developmental biology", "date": "2012", "authors": "Herr P, Basler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22108505", "url": "https://glygen.org/publication/PubMed/22108505" } ] }, { "title": "Wnt/beta-catenin signaling requires interaction of the Dishevelled DEP domain and C terminus with a discontinuous motif in Frizzled.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Tauriello DV, Jordens I, Kirchner K, Slootstra JW, Kruitwagen T, Bouwman BA, Noutsou M, Rudiger SG, Schwamborn K, Schambony A, Maurice MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "22411803", "url": "https://glygen.org/publication/PubMed/22411803" } ] }, { "title": "Structural basis of Wnt recognition by Frizzled.", "journal": "Science (New York, N.Y.)", "date": "2012", "authors": "Janda CY, Waghray D, Levin AM, Thomas C, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22653731", "url": "https://glygen.org/publication/PubMed/22653731" } ] }, { "title": "The Wnt receptor Ryk plays a role in mammalian planar cell polarity signaling.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Macheda ML, Sun WW, Kugathasan K, Hogan BM, Bower NI, Halford MM, Zhang YF, Jacques BE, Lieschke GJ, Dabdoub A, Stacker SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "22773843", "url": "https://glygen.org/publication/PubMed/22773843" } ] }, { "title": "A uniform human Wnt expression library reveals a shared secretory pathway and unique signaling activities.", "journal": "Differentiation; research in biological diversity", "date": "2012", "authors": "Najdi R, Proffitt K, Sprowl S, Kaur S, Yu J, Covey TM, Virshup DM, Waterman ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22784633", "url": "https://glygen.org/publication/PubMed/22784633" } ] }, { "title": "Precise regulation of porcupine activity is required for physiological Wnt signaling.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Proffitt KD, Virshup DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22888000", "url": "https://glygen.org/publication/PubMed/22888000" } ] }, { "title": "Wnt proteins.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Willert K, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22952392", "url": "https://glygen.org/publication/PubMed/22952392" } ] }, { "title": "Active Wnt proteins are secreted on exosomes.", "journal": "Nature cell biology", "date": "2012", "authors": "Gross JC, Chaudhary V, Bartscherer K, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "22983114", "url": "https://glygen.org/publication/PubMed/22983114" } ] }, { "title": "Frat2 mediates the oncogenic activation of Rac by MLL fusions.", "journal": "Blood", "date": "2012", "authors": "Walf-Vorderwulbecke V, de Boer J, Horton SJ, van Amerongen R, Proost N, Berns A, Williams O", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "23074275", "url": "https://glygen.org/publication/PubMed/23074275" } ] }, { "title": "Tiam1 regulates the Wnt/Dvl/Rac1 signaling pathway and the differentiation of midbrain dopaminergic neurons.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Cajanek L, Ganji RS, Henriques-Oliveira C, Theofilopoulos S, Konik P, Bryja V, Arenas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "23109420", "url": "https://glygen.org/publication/PubMed/23109420" } ] }, { "title": "Wnt regulation of planar cell polarity (PCP).", "journal": "Current topics in developmental biology", "date": "2012", "authors": "Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "23140633", "url": "https://glygen.org/publication/PubMed/23140633" } ] }, { "title": "The Wnt coreceptor Ryk regulates Wnt/planar cell polarity by modulating the degradation of the core planar cell polarity component Vangl2.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Andre P, Wang Q, Wang N, Gao B, Schilit A, Halford MM, Stacker SA, Zhang X, Yang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "23144463", "url": "https://glygen.org/publication/PubMed/23144463" } ] }, { "title": "The retromer complex - endosomal protein recycling and beyond.", "journal": "Journal of cell science", "date": "2012", "authors": "Seaman MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "23148298", "url": "https://glygen.org/publication/PubMed/23148298" } ] }, { "title": "A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPARgamma and C/EBPalpha.", "journal": "Journal of bioenergetics and biomembranes", "date": "2013", "authors": "Ni Y, Ji C, Wang B, Qiu J, Wang J, Guo X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "23239344", "url": "https://glygen.org/publication/PubMed/23239344" } ] }, { "title": "The way Wnt works: components and mechanism.", "journal": "Growth factors (Chur, Switzerland)", "date": "2013", "authors": "Saito-Diaz K, Chen TW, Wang X, Thorne CA, Wallace HA, Page-McCaw A, Lee E", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "23256519", "url": "https://glygen.org/publication/PubMed/23256519" } ] }, { "title": "Exosomes mediate stromal mobilization of autocrine Wnt-PCP signaling in breast cancer cell migration.", "journal": "Cell", "date": "2012", "authors": "Luga V, Zhang L, Viloria-Petit AM, Ogunjimi AA, Inanlou MR, Chiu E, Buchanan M, Hosein AN, Basik M, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "23260141", "url": "https://glygen.org/publication/PubMed/23260141" } ] }, { "title": "Functional consequences of Wnt-induced dishevelled 2 phosphorylation in canonical and noncanonical Wnt signaling.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gonzalez-Sancho JM, Greer YE, Abrahams CL, Takigawa Y, Baljinnyam B, Lee KH, Lee KS, Rubin JS, Brown AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "23396967", "url": "https://glygen.org/publication/PubMed/23396967" } ] }, { "title": "Mutations in WNT1 are a cause of osteogenesis imperfecta.", "journal": "J. Med. Genet.", "date": "2013", "authors": "Fahiminiya S, Majewski J, Mort J, Moffatt P, Glorieux FH, Rauch F", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" }, { "database": "dbSNP", "id": "rs387907357", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387907357" } ], "reference": [ { "type": "PubMed", "id": "23434763", "url": "https://glygen.org/publication/PubMed/23434763" } ] }, { "title": "Mutations in WNT1 cause different forms of bone fragility.", "journal": "Am. J. Hum. Genet.", "date": "2013", "authors": "Keupp K, Beleggia F, Kayserili H, Barnes AM, Steiner M, Semler O, Fischer B, Yigit G, Janda CY, Becker J, Breer S, Altunoglu U, Grunhagen J, Krawitz P, Hecht J, Schinke T, Makareeva E, Lausch E, Cankaya T, Caparros-Martin JA, Lapunzina P, Temtamy S, Aglan M, Zabel B, Eysel P, Koerber F, Leikin S, Garcia KC, Netzer C, Schonau E, Ruiz-Perez VL, Mundlos S, Amling M, Kornak U, Marini J, Wollnik B", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "23499309", "url": "https://glygen.org/publication/PubMed/23499309" } ] }, { "title": "WNT1 mutations in families affected by moderately severe and progressive recessive osteogenesis imperfecta.", "journal": "Am. J. Hum. Genet.", "date": "2013", "authors": "Pyott SM, Tran TT, Leistritz DF, Pepin MG, Mendelsohn NJ, Temme RT, Fernandez BA, Elsayed SM, Elsobky E, Verma I, Nair S, Turner EH, Smith JD, Jarvik GP, Byers PH", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "23499310", "url": "https://glygen.org/publication/PubMed/23499310" } ] }, { "title": "WNT1 mutations in early-onset osteoporosis and osteogenesis imperfecta.", "journal": "N. Engl. J. Med.", "date": "2013", "authors": "Laine CM, Joeng KS, Campeau PM, Kiviranta R, Tarkkonen K, Grover M, Lu JT, Pekkinen M, Wessman M, Heino TJ, Nieminen-Pihala V, Aronen M, Laine T, Kroger H, Cole WG, Lehesjoki AE, Nevarez L, Krakow D, Curry CJ, Cohn DH, Gibbs RA, Lee BH, Makitie O", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "23656646", "url": "https://glygen.org/publication/PubMed/23656646" } ] }, { "title": "structural Studies of Wnts and identification of an LRP6 binding site.", "journal": "Structure (London, England : 1993)", "date": "2013", "authors": "Chu ML, Ahn VE, Choi HJ, Daniels DL, Nusse R, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "23791946", "url": "https://glygen.org/publication/PubMed/23791946" } ] }, { "title": "Gpr125 modulates Dishevelled distribution and planar cell polarity signaling.", "journal": "Development (Cambridge, England)", "date": "2013", "authors": "Li X, Roszko I, Sepich DS, Ni M, Hamm HE, Marlow FL, Solnica-Krezel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "23821037", "url": "https://glygen.org/publication/PubMed/23821037" } ] }, { "title": "Novel missense loss-of-function mutations of WNT1 in an autosomal recessive Osteogenesis imperfecta patient.", "journal": "Eur. J. Med. Genet.", "date": "2017", "authors": "Won JY, Jang WY, Lee HR, Park SY, Kim WY, Park JH, Kim Y, Cho TJ", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "28528193", "url": "https://glygen.org/publication/PubMed/28528193" } ] }, { "title": "The nucleotide sequence of the human int-1 mammary oncogene; evolutionary conservation of coding and non-coding sequences.", "journal": "EMBO J.", "date": "1985", "authors": "van Ooyen A, Kwee V, Nusse R", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "reference": [ { "type": "PubMed", "id": "2998762", "url": "https://glygen.org/publication/PubMed/2998762" } ] }, { "title": "A parathyroid hormone-related protein implicated in malignant hypercalcemia: cloning and expression.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Suva LJ, Winslow GA, Wettenhall RE, Hammonds RG, Moseley JM, Diefenbach-Jagger H, Rodda CP, Kemp BE, Rodriguez H, Chen EY, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "3616618", "url": "https://glygen.org/publication/PubMed/3616618" } ] }, { "title": "Osteoporosis related to WNT1 variants: a not infrequent cause of osteoporosis.", "journal": "Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA", "date": "2023", "authors": "Peris P, Monegal A, Makitie RE, Guanabens N, Gonzalez-Roca E", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ], "reference": [ { "type": "PubMed", "id": "36396825", "url": "https://glygen.org/publication/PubMed/36396825" } ] }, { "title": "Wnt/beta-catenin signaling and its modulators in nonalcoholic fatty liver diseases.", "journal": "Hepatobiliary & pancreatic diseases international : HBPD INT", "date": "2023-08", "authors": "Shree Harini Karthik, Ezhilarasan Devaraj", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ], "reference": [ { "type": "PubMed", "id": "36448560", "url": "https://glygen.org/publication/PubMed/36448560" } ] }, { "title": "Genotypic and phenotypic spectrum and pathogenesis of WNT1 variants in a large cohort of patients with OI/osteoporosis.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2023-01-03", "authors": "Hu Jing, Lin Xiaoyun, Gao Peng, Zhang Qian, Zhou Bingna, Wang Ou, Jiang Yan, Xia Weibo, Xing Xiaoping, Li Mei", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ], "reference": [ { "type": "PubMed", "id": "36595228", "url": "https://glygen.org/publication/PubMed/36595228" } ] }, { "title": "KLF3 Transcription Activates WNT1 and Promotes the Growth and Metastasis of Gastric Cancer via Activation of the WNT/\u03b2-Catenin Signaling Pathway.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2023-02-01", "authors": "Li Ying, Wang Yu, Zou Qinguang, Li Shouqing, Zhang Fan", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ], "reference": [ { "type": "PubMed", "id": "36827869", "url": "https://glygen.org/publication/PubMed/36827869" } ] }, { "title": "Association of Membranous WNT-1 and Nuclear mTOR with Endometrial Cancer Grade.", "journal": "International journal of molecular sciences", "date": "2023-05-06", "authors": "Pietrus Milosz, Pitynski Kazimierz, Waligora Marcin, Milian-Ciesielska Katarzyna, Ludwin Artur, Socha Maciej W, Skrzypek Klaudia", "evidence": [ { "database": "RefSeq", "id": "NP_005421", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005421" } ], "reference": [ { "type": "PubMed", "id": "37176048", "url": "https://glygen.org/publication/PubMed/37176048" } ] }, { "title": "Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Hendy GN, Kronenberg HM, Potts JT Jr, Rich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "6950381", "url": "https://glygen.org/publication/PubMed/6950381" } ] }, { "title": "Identification and functional expression of a receptor selectively recognizing parathyroid hormone, the PTH2 receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Usdin TB, Gruber C, Bonner TI", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "7797535", "url": "https://glygen.org/publication/PubMed/7797535" } ] }, { "title": "A C-terminally truncated human parathyroid hormone receptor is functional and activates multiple G proteins.", "journal": "FEBS letters", "date": "1994", "authors": "Schneider H, Feyen JH, Seuwen K", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8082781", "url": "https://glygen.org/publication/PubMed/8082781" } ] }, { "title": "Wnt family proteins are secreted and associated with the cell surface.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Smolich BD, McMahon JA, McMahon AP, Papkoff J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "8167409", "url": "https://glygen.org/publication/PubMed/8167409" } ] }, { "title": "Cloning and structure of the human corticotrophin releasing factor-binding protein gene (CRHBP)", "journal": "Genomics", "date": "1993", "authors": "Behan DP, Potter E, Lewis KA, Jenkins NA, Copeland N, Lowry PJ, Vale WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8198617", "url": "https://glygen.org/publication/PubMed/8198617" } ] }, { "title": "Mutations in the segment polarity genes wingless and porcupine impair secretion of the wingless protein.", "journal": "The EMBO journal", "date": "1993", "authors": "van den Heuvel M, Harryman-Samos C, Klingensmith J, Perrimon N, Nusse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "8262072", "url": "https://glygen.org/publication/PubMed/8262072" } ] }, { "title": "Insulin-responsive human adipocytes express two glucose transporter isoforms and target them to different vesicles.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1993", "authors": "Pilch PF, Wilkinson W, Garvey WT, Ciaraldi TP, Hueckstaedt TP, Olefsky JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8325954", "url": "https://glygen.org/publication/PubMed/8325954" } ] }, { "title": "Identical complementary deoxyribonucleic acids encode a human renal and bone parathyroid hormone (PTH)/PTH-related peptide receptor.", "journal": "Endocrinology", "date": "1993", "authors": "Schipani E, Karga H, Karaplis AC, Potts JT Jr, Kronenberg HM, Segre GV, Abou-Samra AB, Juppner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8386612", "url": "https://glygen.org/publication/PubMed/8386612" } ] }, { "title": "Cloning and functional expression of a human parathyroid hormone receptor.", "journal": "European journal of pharmacology", "date": "1993", "authors": "Schneider H, Feyen JH, Seuwen K, Movva NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8397094", "url": "https://glygen.org/publication/PubMed/8397094" } ] }, { "title": "Corticotropin releasing factor (CRF) binding protein: a novel regulator of CRF and related peptides.", "journal": "Frontiers in neuroendocrinology", "date": "1995", "authors": "Behan DP, De Souza EB, Lowry PJ, Potter E, Sawchenko P, Vale WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8557170", "url": "https://glygen.org/publication/PubMed/8557170" } ] }, { "title": "Cloning and characterization of human urocortin.", "journal": "Endocrinology", "date": "1996", "authors": "Donaldson CJ, Sutton SW, Perrin MH, Corrigan AZ, Lewis KA, Rivier JE, Vaughan JM, Vale WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8612563", "url": "https://glygen.org/publication/PubMed/8612563" } ] }, { "title": "The adipocyte specific transcription factor C/EBPalpha modulates human ob gene expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Miller SG, De Vos P, Guerre-Millo M, Wong K, Hermann T, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8643605", "url": "https://glygen.org/publication/PubMed/8643605" } ] }, { "title": "A human peroxisome-proliferator-activated receptor-gamma is activated by inducers of adipogenesis, including thiazolidinedione drugs.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Lambe KG, Tugwood JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8706692", "url": "https://glygen.org/publication/PubMed/8706692" } ] }, { "title": "G alpha q family members couple parathyroid hormone (PTH)/PTH-related peptide and calcitonin receptors to phospholipase C in COS-7 cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1996", "authors": "Offermanns S, Iida-Klein A, Segre GV, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8732687", "url": "https://glygen.org/publication/PubMed/8732687" } ] }, { "title": "Thiazolidinediones repress ob gene expression in rodents via activation of peroxisome proliferator-activated receptor gamma.", "journal": "The Journal of clinical investigation", "date": "1996", "authors": "De Vos P, Lefebvre AM, Miller SG, Guerre-Millo M, Wong K, Saladin R, Hamann LG, Staels B, Briggs MR, Auwerx J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8770873", "url": "https://glygen.org/publication/PubMed/8770873" } ] }, { "title": "The human PTH2 receptor: binding and signal transduction properties of the stably expressed recombinant receptor.", "journal": "Endocrinology", "date": "1996", "authors": "Behar V, Pines M, Nakamoto C, Greenberg Z, Bisello A, Stueckle SM, Bessalle R, Usdin TB, Chorev M, Rosenblatt M, Suva LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8770894", "url": "https://glygen.org/publication/PubMed/8770894" } ] }, { "title": "The tumour-suppressor gene patched encodes a candidate receptor for Sonic hedgehog.", "journal": "Nature", "date": "1996", "authors": "Stone DM, Hynes M, Armanini M, Swanson TA, Gu Q, Johnson RL, Scott MP, Pennica D, Goddard A, Phillips H, Noll M, Hooper JE, de Sauvage F, Rosenthal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "8906787", "url": "https://glygen.org/publication/PubMed/8906787" } ] }, { "title": "Peroxisome proliferator-activated receptors: a nuclear receptor signaling pathway in lipid physiology.", "journal": "Annual review of cell and developmental biology", "date": "1996", "authors": "Lemberger T, Desvergne B, Wahli W", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "8970730", "url": "https://glygen.org/publication/PubMed/8970730" } ] }, { "title": "The segment polarity gene porcupine encodes a putative multitransmembrane protein involved in Wingless processing.", "journal": "Genes & development", "date": "1996", "authors": "Kadowaki T, Wilder E, Klingensmith J, Zachary K, Perrimon N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3238698", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698" } ], "reference": [ { "type": "PubMed", "id": "8985181", "url": "https://glygen.org/publication/PubMed/8985181" } ] }, { "title": "Activation of a novel proto-oncogene, Frat1, contributes to progression of mouse T-cell lymphomas.", "journal": "The EMBO journal", "date": "1997", "authors": "Jonkers J, Korswagen HC, Acton D, Breuer M, Berns A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "9034327", "url": "https://glygen.org/publication/PubMed/9034327" } ] }, { "title": "The seven-span transmembrane receptor CD97 has a cellular ligand (CD55, DAF).", "journal": "The Journal of experimental medicine", "date": "1996", "authors": "Hamann J, Vogel B, van Schijndel GM, van Lier RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-373080", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080" } ], "reference": [ { "type": "PubMed", "id": "9064337", "url": "https://glygen.org/publication/PubMed/9064337" } ] }, { "title": "Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mukherjee R, Jow L, Croston GE, Paterniti JR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9065481", "url": "https://glygen.org/publication/PubMed/9065481" } ] }, { "title": "Dominant-negative mutants of importin-beta block multiple pathways of import and export through the nuclear pore complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Kutay U, Izaurralde E, Bischoff FR, Mattaj IW, Gorlich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "9135132", "url": "https://glygen.org/publication/PubMed/9135132" } ] }, { "title": "Evolutionary specialization of the nuclear targeting apparatus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Malik HS, Eickbush TH, Goldfarb DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "9391096", "url": "https://glygen.org/publication/PubMed/9391096" } ] }, { "title": "Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Young PW, Buckle DR, Cantello BC, Chapman H, Clapham JC, Coyle PJ, Haigh D, Hindley RM, Holder JC, Kallender H, Latter AJ, Lawrie KW, Mossakowska D, Murphy GJ, Roxbee Cox L, Smith SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9454824", "url": "https://glygen.org/publication/PubMed/9454824" } ] }, { "title": "Axin, a negative regulator of the Wnt signaling pathway, forms a complex with GSK-3beta and beta-catenin and promotes GSK-3beta-dependent phosphorylation of beta-catenin.", "journal": "The EMBO journal", "date": "1998", "authors": "Ikeda S, Kishida S, Yamamoto H, Murai H, Koyama S, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "9482734", "url": "https://glygen.org/publication/PubMed/9482734" } ] }, { "title": "Nuclear localization signal-independent and importin/karyopherin-independent nuclear import of beta-catenin.", "journal": "Current biology : CB", "date": "1998", "authors": "Fagotto F, Gluck U, Gumbiner BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-201681", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681" } ], "reference": [ { "type": "PubMed", "id": "9501980", "url": "https://glygen.org/publication/PubMed/9501980" } ] }, { "title": "GBP, an inhibitor of GSK-3, is implicated in Xenopus development and oncogenesis.", "journal": "Cell", "date": "1998", "authors": "Yost C, Farr GH 3rd, Pierce SB, Ferkey DM, Chen MM, Kimelman D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4641262", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262" } ], "reference": [ { "type": "PubMed", "id": "9635432", "url": "https://glygen.org/publication/PubMed/9635432" } ] }, { "title": "Dishevelled activates JNK and discriminates between JNK pathways in planar polarity and wingless signaling.", "journal": "Cell", "date": "1998", "authors": "Boutros M, Paricio N, Strutt DI, Mlodzik M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "9674432", "url": "https://glygen.org/publication/PubMed/9674432" } ] }, { "title": "Differential recruitment of Dishevelled provides signaling specificity in the planar cell polarity and Wingless signaling pathways.", "journal": "Genes & development", "date": "1998", "authors": "Axelrod JD, Miller JR, Shulman JM, Moon RT, Perrimon N", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086400", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400" } ], "reference": [ { "type": "PubMed", "id": "9716412", "url": "https://glygen.org/publication/PubMed/9716412" } ] }, { "title": "N-(2-Benzoylphenyl)-L-tyrosine PPARgamma agonists. 1. Discovery of a novel series of potent antihyperglycemic and antihyperlipidemic agents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Henke BR, Blanchard SG, Brackeen MF, Brown KK, Cobb JE, Collins JL, Harrington WW Jr, Hashim MA, Hull-Ryde EA, Kaldor I, Kliewer SA, Lake DH, Leesnitzer LM, Lehmann JM, Lenhard JM, Orband-Miller LA, Miller JF, Mook RA Jr, Noble SA, Oliver W Jr, Parks DJ, Plunket KD, Szewczyk JR, Willson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381340", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340" } ], "reference": [ { "type": "PubMed", "id": "9836620", "url": "https://glygen.org/publication/PubMed/9836620" } ] } ], "pathway": [ { "id": "hsa:7471", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7471", "resource": "KEGG Pathway" }, { "id": "R-HSA-201681", "name": "TCF dependent signaling in response to WNT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-201681", "resource": "Reactome", "description": "TCF dependent signaling in response to WNT" }, { "id": "R-HSA-3238698", "name": "WNT ligand biogenesis and trafficking", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3238698", "resource": "Reactome", "description": "WNT ligand biogenesis and trafficking" }, { "id": "R-HSA-373080", "name": "Class B/2 (Secretin family receptors)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373080", "resource": "Reactome", "description": "Class B/2 (Secretin family receptors)" }, { "id": "R-HSA-381340", "name": "Transcriptional regulation of white adipocyte differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381340", "resource": "Reactome", "description": "Transcriptional regulation of white adipocyte differentiation" }, { "id": "R-HSA-4086400", "name": "PCP/CE pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086400", "resource": "Reactome", "description": "PCP/CE pathway" }, { "id": "R-HSA-4641262", "name": "Disassembly of the destruction complex and recruitment of AXIN to the membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641262", "resource": "Reactome", "description": "Disassembly of the destruction complex and recruitment of AXIN to the membrane" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A9J2-1", "protein_name": "Protein Wnt", "gene_name": "Wnt1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGLWALLPSWVSATLLLALTALPAALGANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL", "length": 370 }, "evidence": [ { "id": "45224540", "url": "http://www.informatics.jax.org/homology/45224540", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04426-1", "protein_name": "Proto-oncogene Wnt-1", "gene_name": "Wnt1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL", "length": 370 }, "evidence": [ { "id": "45224540", "url": "http://www.informatics.jax.org/homology/45224540", "database": "MGI" }, { "id": "P04628", "url": "https://omabrowser.org/oma/group/P04628/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P09615-1", "protein_name": "Protein wingless", "gene_name": "wg", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MDISYIFVICLMALCSGGSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTCL", "length": 468 }, "evidence": [ { "id": "P04628", "url": "https://omabrowser.org/oma/group/P04628/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 52, "go_terms": [ { "name": "ubiquitin-dependent SMAD protein catabolic process", "id": "GO:0030579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030579", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "embryonic axis specification", "id": "GO:0000578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000578", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "central nervous system morphogenesis", "id": "GO:0021551", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021551", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "diencephalon development", "id": "GO:0021536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021536", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "inner ear morphogenesis", "id": "GO:0042472", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042472", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of DNA-binding transcription factor activity", "id": "GO:0051091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "response to wounding", "id": "GO:0009611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009611", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of Notch signaling pathway", "id": "GO:0045747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045747", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of cell-cell adhesion", "id": "GO:0022408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022408", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of BMP signaling pathway", "id": "GO:0030514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030514", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "signal transduction in response to DNA damage", "id": "GO:0042770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042770", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of cellular senescence", "id": "GO:2000773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000773", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "myoblast fusion", "id": "GO:0007520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007520", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "animal organ regeneration", "id": "GO:0031100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031100", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway", "id": "GO:0060070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060070", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "bone development", "id": "GO:0060348", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060348", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cellular response to peptide hormone stimulus", "id": "GO:0071375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071375", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of insulin-like growth factor receptor signaling pathway", "id": "GO:0043568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043568", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of fat cell differentiation", "id": "GO:0045599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045599", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0030512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030512", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "T cell differentiation in thymus", "id": "GO:0033077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033077", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of cell-substrate adhesion", "id": "GO:0010812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010812", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "hepatocyte differentiation", "id": "GO:0070365", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070365", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of lamellipodium assembly", "id": "GO:0010592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010592", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of ubiquitin-dependent protein catabolic process", "id": "GO:2000059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000059", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "spinal cord association neuron differentiation", "id": "GO:0021527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021527", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "hematopoietic stem cell proliferation", "id": "GO:0071425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071425", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "branching involved in ureteric bud morphogenesis", "id": "GO:0001658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001658", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "embryonic brain development", "id": "GO:1990403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990403", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cell proliferation in midbrain", "id": "GO:0033278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033278", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of hematopoietic stem cell proliferation", "id": "GO:1902035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902035", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cell fate commitment", "id": "GO:0045165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045165", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "forebrain anterior/posterior pattern specification", "id": "GO:0021797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021797", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cerebellum formation", "id": "GO:0021588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021588", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "midbrain-hindbrain boundary maturation during brain development", "id": "GO:0022004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022004", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "astrocyte-dopaminergic neuron signaling", "id": "GO:0036520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036520", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "midbrain development", "id": "GO:0030901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030901", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "neuron fate determination", "id": "GO:0048664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048664", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation", "id": "GO:1904954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904954", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "Spemann organizer formation", "id": "GO:0060061", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060061", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation", "id": "GO:1904953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904953", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway", "id": "GO:1903377", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903377", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "positive regulation of dermatome development", "id": "GO:0061184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061184", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "frizzled binding", "id": "GO:0005109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005109", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "morphogen activity", "id": "GO:0016015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016015", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" }, { "name": "endocytic vesicle membrane", "id": "GO:0030666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030666", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" }, { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 346, "end_pos": 348, "annotation": "n_glycosylation_sequon" }, { "start_pos": 359, "end_pos": 361, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoleoylation is required for efficient binding to frizzled receptors. Palmitoleoylation is necessary for proper trafficking to cell surface (Probable). Depalmitoleoylated by NOTUM, leading to inhibit Wnt signaling pathway (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P04628", "url": "https://www.uniprot.org/uniprot/P04628" }, { "database": "PubMed", "id": "Q91029", "url": "https://glygen.org/publication/PubMed/Q91029" }, { "database": "PubMed", "id": "21244856", "url": "https://glygen.org/publication/PubMed/21244856" }, { "database": "PubMed", "id": "P56704", "url": "https://glygen.org/publication/PubMed/P56704" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 215 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }