{ "uniprot_canonical_ac": "P04054-1", "uniprot_ac": "P04054", "uniprot_id": "PA21B_HUMAN", "mass": { "chemical_mass": 16360.0, "monoisotopic_mass": 16360.0 }, "refseq": { "ac": "NP_000919", "name": "phospholipase A2 precursor", "summary": "This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, "gene_names": [ { "name": "PLA2G1B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04054", "id": "P04054" }, { "name": "PLA2; PLA2A; PPLA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919", "id": "NP_000919" }, { "name": "PLA2A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04054", "id": "P04054" }, { "name": "PLA2G1B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919", "id": "NP_000919" }, { "name": "PLA2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04054", "id": "P04054" }, { "name": "PPLA2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04054", "id": "P04054" } ], "protein_names": [ { "name": "Phospholipase A2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04054" }, { "name": "3.1.1.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04054" }, { "name": "Group IB phospholipase A2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04054" }, { "name": "Phosphatidylcholine 2-acylhydrolase 1B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04054" }, { "name": "phosphatidylcholine 2-acylhydrolase 1B; phospholipase A2, group IB (pancreas)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919", "id": "NP_000919" }, { "name": "phospholipase A2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919", "id": "NP_000919" } ], "function": [ { "annotation": "Genetic analysis of pancreatic phospholipase A2 (PLA2G1B) in patients with chronic pancreatitis.", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, { "database": "PubMed", "id": "35031208", "url": "https://glygen.org/publication/PubMed/35031208" } ] }, { "annotation": "Microbial Protein Binding to gC1qR Drives PLA2G1B-Induced CD4 T-Cell Anergy. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, { "database": "PubMed", "id": "35392090", "url": "https://glygen.org/publication/PubMed/35392090" } ] }, { "annotation": "PLA2G1B is involved in CD4 anergy and CD4 lymphopenia in HIV-infected patients.", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, { "database": "PubMed", "id": "32436864", "url": "https://glygen.org/publication/PubMed/32436864" } ] }, { "annotation": "SPLA2-IB Level Correlates with Hyperlipidemia and the Prognosis of Idiopathic Membranous Nephropathy.", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, { "database": "PubMed", "id": "32862379", "url": "https://glygen.org/publication/PubMed/32862379" } ] }, { "annotation": "SPLA2-IB and PLA2R mediate insufficient autophagy and contribute to podocyte injury in idiopathic membranous nephropathy by activation of the p38MAPK/mTOR/ULK1(ser757) signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" }, { "database": "PubMed", "id": "33184968", "url": "https://glygen.org/publication/PubMed/33184968" } ] }, { "annotation": "Secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract (PubMed:1420353, PubMed:10681567, PubMed:17603006). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines (PubMed:1420353, PubMed:10681567, PubMed:17603006). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation in the intestinal tract. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (By similarity). May act in an autocrine and paracrine manner (PubMed:7721806, PubMed:25335547). Upon binding to the PLA2R1 receptor can regulate podocyte survival and glomerular homeostasis (PubMed:25335547). Has anti-helminth activity in a process regulated by gut microbiota. Upon helminth infection of intestinal epithelia, directly affects phosphatidylethanolamine contents in the membrane of helminth larvae, likely controlling an array of phospholipid-mediated cellular processes such as membrane fusion and cell division while providing for better immune recognition, ultimately reducing larvae integrity and infectivity (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054#function" }, { "database": "PubMed", "id": "7721806", "url": "https://glygen.org/publication/PubMed/7721806" }, { "database": "UniProtKB", "id": "P04055", "url": "https://www.uniprot.org/uniprot/P04055#function" }, { "database": "PubMed", "id": "10681567", "url": "https://glygen.org/publication/PubMed/10681567" }, { "database": "UniProtKB", "id": "Q9Z0Y2", "url": "https://www.uniprot.org/uniprot/Q9Z0Y2#function" }, { "database": "PubMed", "id": "25335547", "url": "https://glygen.org/publication/PubMed/25335547" }, { "database": "PubMed", "id": "1420353", "url": "https://glygen.org/publication/PubMed/1420353" }, { "database": "PubMed", "id": "17603006", "url": "https://glygen.org/publication/PubMed/17603006" } ] }, { "annotation": "This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "76.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "39.32", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "62.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "54.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "71.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "45.93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "68.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "68.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04054", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04054" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "common_name": "Human" } ], "gene": [ { "name": "PLA2G1B", "url": "https://www.uniprot.org/uniprot/P04054", "locus": { "chromosome": "12", "start_pos": 120322115, "end_pos": 120327779, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000170890", "url": "https://www.ensembl.org/id/ENSG00000170890" } ] } } ], "crossref": [ { "id": "ENSG00000170890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170890", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00125", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00125", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4426", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4426", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PLA2G1B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLA2G1B", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "5319", "url": "https://www.ncbi.nlm.nih.gov/gene/5319", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9030", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9030", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04054", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04054*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001211", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001211", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016090", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016090", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033112", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033112", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033113", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033113", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036444", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036444", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5319", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5319", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "172410", "url": "http://www.omim.org/entry/172410", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04054", "url": "https://www.nextprot.org/entry/NX_P04054", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "ELDTCCQ", "url": "https://omabrowser.org/oma/group/ELDTCCQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "638584at2759", "url": "http://www.orthodb.org/?query=638584at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11716", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11716", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11716:SF94", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11716:SF94", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3ELO", "url": "https://www.rcsb.org/structure/3ELO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q42", "url": "https://www.rcsb.org/structure/6Q42", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00068", "url": "http://pfam.xfam.org/family/PF00068", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04054", "url": "https://pharos.nih.gov/targets/P04054", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04054", "url": "http://purl.obolibrary.org/obo/PR_P04054", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1482922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482922", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "15801", "url": "https://www.rhea-db.org/rhea/15801", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38779", "url": "https://www.rhea-db.org/rhea/38779", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40427", "url": "https://www.rhea-db.org/rhea/40427", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40815", "url": "https://www.rhea-db.org/rhea/40815", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40919", "url": "https://www.rhea-db.org/rhea/40919", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41223", "url": "https://www.rhea-db.org/rhea/41223", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "45424", "url": "https://www.rhea-db.org/rhea/45424", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54456", "url": "https://www.rhea-db.org/rhea/54456", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56424", "url": "https://www.rhea-db.org/rhea/56424", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F8W062", "url": "https://www.uniprot.org/uniprot/F8W062", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W062-1", "url": "https://www.uniprot.org/uniprot/F8W062-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04054-1", "url": "https://www.uniprot.org/uniprot/P04054-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9BS22", "url": "https://www.uniprot.org/uniprot/Q9BS22", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9BS22-1", "url": "https://www.uniprot.org/uniprot/Q9BS22-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS", "length": 148, "header": "sp|P04054-1|PA21B_HUMAN Isoform 1 of Phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G1B PE=1 SV=3 CANONICAL=P04054-1" }, "isoforms": [ { "isoform_ac": "F8W062-1", "url": "", "sequence": { "sequence": "MIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS", "length": 119, "header": "tr|F8W062-1|F8W062_HUMAN Computationally mapped isoform of Phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G1B PE=1 SV=1 CANONICAL=P04054-1" }, "locus": { "chromosome": "12", "start_pos": 120325967, "end_pos": 120322196, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000549767.1", "url": "https://www.ensembl.org/id/ENST00000549767.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000447233.1", "url": "https://www.ensembl.org/id/ENSP00000447233.1" } ] } }, { "isoform_ac": "P04054-1", "url": "", "sequence": { "sequence": "MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS", "length": 148, "header": "sp|P04054-1|PA21B_HUMAN Isoform 1 of Phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G1B PE=1 SV=3 CANONICAL=P04054-1" }, "locus": { "chromosome": "12", "start_pos": 120327753, "end_pos": 120322196, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000308366.9", "url": "https://www.ensembl.org/id/ENST00000308366.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000312286.4", "url": "https://www.ensembl.org/id/ENSP00000312286.4" } ] } }, { "isoform_ac": "Q9BS22-1", "url": "", "sequence": { "sequence": "MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV", "length": 70, "header": "tr|Q9BS22-1|Q9BS22_HUMAN Computationally mapped isoform of Phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G1B PE=1 SV=1 CANONICAL=P04054-1" }, "locus": { "chromosome": "12", "start_pos": 120327753, "end_pos": 120322302, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423423.3", "url": "https://www.ensembl.org/id/ENST00000423423.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000413594.3", "url": "https://www.ensembl.org/id/ENSP00000413594.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Molecular cloning of two new human paralogs of 85-kDa cytosolic phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Pickard RT, Strifler BA, Kramer RM, Sharp JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "10085124", "url": "https://glygen.org/publication/PubMed/10085124" } ] }, { "title": "Human pancreatic islets express mRNA species encoding two distinct catalytically active isoforms of group VI phospholipase A2 (iPLA2) that arise from an exon-skipping mechanism of alternative splicing of the transcript from the iPLA2 gene on chromosome 22q13.1.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ma Z, Wang X, Nowatzke W, Ramanadham S, Turk J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "10092647", "url": "https://glygen.org/publication/PubMed/10092647" } ] }, { "title": "An alternative splicing form of phosphatidylserine-specific phospholipase A1 that exhibits lysophosphatidylserine-specific lysophospholipase activity in humans.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Nagai Y, Aoki J, Sato T, Amano K, Matsuda Y, Arai H, Inoue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "10196188", "url": "https://glygen.org/publication/PubMed/10196188" } ] }, { "title": "The human calcium-independent phospholipase A2 gene multiple enzymes with distinct properties from a single gene.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Larsson Forsell PK, Kennedy BP, Claesson HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "10336645", "url": "https://glygen.org/publication/PubMed/10336645" } ] }, { "title": "Molecular characterization of cytosolic phospholipase A2-beta.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Song C, Chang XJ, Bean KM, Proia MS, Knopf JL, Kriz RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "10358058", "url": "https://glygen.org/publication/PubMed/10358058" } ] }, { "title": "Cloning and characterization of novel mouse and human secretory phospholipase A(2)s.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ishizaki J, Suzuki N, Higashino K, Yokota Y, Ono T, Kawamoto K, Fujii N, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "10455175", "url": "https://glygen.org/publication/PubMed/10455175" } ] }, { "title": "Isolation of a cDNA encoding human lysophosphatidic acid phosphatase that is involved in the regulation of mitochondrial lipid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hiroyama M, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10506173", "url": "https://glygen.org/publication/PubMed/10506173" } ] }, { "title": "Ether lipid biosynthesis: alkyl-dihydroxyacetonephosphate synthase protein deficiency leads to reduced dihydroxyacetonephosphate acyltransferase activities.", "journal": "Journal of lipid research", "date": "1999", "authors": "de Vet EC, Ijlst L, Oostheim W, Dekker C, Moser HW, van Den Bosch H, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10553003", "url": "https://glygen.org/publication/PubMed/10553003" } ] }, { "title": "Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Suzuki N, Ishizaki J, Yokota Y, Higashino K, Ono T, Ikeda M, Fujii N, Kawamoto K, Hanasaki K", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" }, { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "10681567", "url": "https://glygen.org/publication/PubMed/10681567" } ] }, { "title": "Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Gelb MH, Valentin E, Ghomashchi F, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "11031251", "url": "https://glygen.org/publication/PubMed/11031251" } ] }, { "title": "Cloning and recombinant expression of human group IIF-secreted phospholipase A(2).", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Valentin E, Singer AG, Ghomashchi F, Lazdunski M, Gelb MH, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "11112443", "url": "https://glygen.org/publication/PubMed/11112443" } ] }, { "title": "A novel phospholipase A1 with sequence homology to a mammalian Sec23p-interacting protein, p125.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nakajima K, Sonoda H, Mizoguchi T, Aoki J, Arai H, Nagahama M, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11788596", "url": "https://glygen.org/publication/PubMed/11788596" } ] }, { "title": "Identification of a soluble form phospholipase A2 receptor as a circulating endogenous inhibitor for secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Higashino Ki K, Yokota Y, Ono T, Kamitani S, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "11830583", "url": "https://glygen.org/publication/PubMed/11830583" } ] }, { "title": "A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12063250", "url": "https://glygen.org/publication/PubMed/12063250" } ] }, { "title": "Human epidermis is a novel site of phospholipase B expression.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Maury E, Prevost MC, Nauze M, Redoules D, Tarroux R, Charveron M, Salles JP, Perret B, Chap H, Gassama-Diagne A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "12150957", "url": "https://glygen.org/publication/PubMed/12150957" } ] }, { "title": "Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Pan YH, Yu BZ, Singer AG, Ghomashchi F, Lambeau G, Gelb MH, Jain MK, Bahnson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "12161451", "url": "https://glygen.org/publication/PubMed/12161451" } ] }, { "title": "Interfacial kinetic and binding properties of the complete set of human and mouse groups I, II, V, X, and XII secreted phospholipases A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Singer AG, Ghomashchi F, Le Calvez C, Bollinger J, Bezzine S, Rouault M, Sadilek M, Nguyen E, Lazdunski M, Lambeau G, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12359733", "url": "https://glygen.org/publication/PubMed/12359733" } ] }, { "title": "Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Murakami M, Masuda S, Shimbara S, Bezzine S, Lazdunski M, Lambeau G, Gelb MH, Matsukura S, Kokubu F, Adachi M, Kudo I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "12522102", "url": "https://glygen.org/publication/PubMed/12522102" } ] }, { "title": "Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12963729", "url": "https://glygen.org/publication/PubMed/12963729" } ] }, { "title": "Characterization of recombinant human and rat pancreatic phospholipases A2 secreted from Saccharomyces cerevisiae: difference in proteolytic processing.", "journal": "Biochim. Biophys. Acta", "date": "1992", "authors": "Yoshida N., Kanda A., Teraoka H., Nakamura E., Tamaki M.", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "1420353", "url": "https://glygen.org/publication/PubMed/1420353" } ] }, { "title": "Phospholipid scramblase 3 controls mitochondrial structure, function, and apoptotic response.", "journal": "Molecular cancer research : MCR", "date": "2003", "authors": "Liu J, Dai Q, Chen J, Durrant D, Freeman A, Liu T, Grossman D, Lee RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "14573790", "url": "https://glygen.org/publication/PubMed/14573790" } ] }, { "title": "Cloning of a gene for a novel epithelium-specific cytosolic phospholipase A2, cPLA2delta, induced in psoriatic skin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chiba H, Michibata H, Wakimoto K, Seishima M, Kawasaki S, Okubo K, Mitsui H, Torii H, Imai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "14709560", "url": "https://glygen.org/publication/PubMed/14709560" } ] }, { "title": "Cloning and characterization of murine 1-acyl-sn-glycerol 3-phosphate acyltransferases and their regulation by PPARalpha in murine heart.", "journal": "The Biochemical journal", "date": "2005", "authors": "Lu B, Jiang YJ, Zhou Y, Xu FY, Hatch GM, Choy PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "15367102", "url": "https://glygen.org/publication/PubMed/15367102" } ] }, { "title": "Identification and characterization of a gene encoding human LPGAT1, an endoplasmic reticulum-associated lysophosphatidylglycerol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yang Y, Cao J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "15485873", "url": "https://glygen.org/publication/PubMed/15485873" } ] }, { "title": "Group VIB Ca2+-independent phospholipase A2gamma promotes cellular membrane hydrolysis and prostaglandin production in a manner distinct from other intracellular phospholipases A2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Murakami M, Masuda S, Ueda-Semmyo K, Yoda E, Kuwata H, Takanezawa Y, Aoki J, Arai H, Sumimoto H, Ishikawa Y, Ishii T, Nakatani Y, Kudo I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "15695510", "url": "https://glygen.org/publication/PubMed/15695510" } ] }, { "title": "Cellular distribution, post-translational modification, and tumorigenic potential of human group III secreted phospholipase A(2).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Murakami M, Masuda S, Shimbara S, Ishikawa Y, Ishii T, Kudo I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "15863501", "url": "https://glygen.org/publication/PubMed/15863501" } ] }, { "title": "Roles of C-terminal processing, and involvement in transacylation reaction of human group IVC phospholipase A2 (cPLA2gamma).", "journal": "Journal of biochemistry", "date": "2005", "authors": "Yamashita A, Kamata R, Kawagishi N, Nakanishi H, Suzuki H, Sugiura T, Waku K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "15944408", "url": "https://glygen.org/publication/PubMed/15944408" } ] }, { "title": "Substrate specificity of phospholipase B from guinea pig intestine. A glycerol ester lipase with broad specificity.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Gassama-Diagne A, Rogalle P, Fauvel J, Willson M, Klaebe A, Chap H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "1618844", "url": "https://glygen.org/publication/PubMed/1618844" } ] }, { "title": "Cloning and characterization a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase gene AGPAT7.", "journal": "DNA sequence : the journal of DNA sequencing and mapping", "date": "2005", "authors": "Ye GM, Chen C, Huang S, Han DD, Guo JH, Wan B, Yu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "16243729", "url": "https://glygen.org/publication/PubMed/16243729" } ] }, { "title": "Crystal structures of human glycerol 3-phosphate dehydrogenase 1 (GPD1).", "journal": "Journal of molecular biology", "date": "2006", "authors": "Ou X, Ji C, Han X, Zhao X, Li X, Mao Y, Wong LL, Bartlam M, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16460752", "url": "https://glygen.org/publication/PubMed/16460752" } ] }, { "title": "A regulatory role for 1-acylglycerol-3-phosphate-O-acyltransferase 2 in adipocyte differentiation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gale SE, Frolov A, Han X, Bickel PE, Cao L, Bowcock A, Schaffer JE, Ory DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16495223", "url": "https://glygen.org/publication/PubMed/16495223" } ] }, { "title": "Identification of the expressed form of human cytosolic phospholipase A2beta (cPLA2beta): cPLA2beta3 is a novel variant localized to mitochondria and early endosomes.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Ghosh M, Loper R, Gelb MH, Leslie CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "16617059", "url": "https://glygen.org/publication/PubMed/16617059" } ] }, { "title": "Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Agarwal AK, Barnes RI, Garg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16620771", "url": "https://glygen.org/publication/PubMed/16620771" } ] }, { "title": "Cloning and characterization of mouse lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1 (LPCAT1). Expression in alveolar type II cells and possible involvement in surfactant production.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Nakanishi H, Shindou H, Hishikawa D, Harayama T, Ogasawara R, Suwabe A, Taguchi R, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "16704971", "url": "https://glygen.org/publication/PubMed/16704971" } ] }, { "title": "Endocannabinoid biosynthesis proceeding through glycerophospho-N-acyl ethanolamine and a role for alpha/beta-hydrolase 4 in this pathway.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Simon GM, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "16818490", "url": "https://glygen.org/publication/PubMed/16818490" } ] }, { "title": "Identification and characterization of a lysophosphatidylcholine acyltransferase in alveolar type II cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Chen X, Hyatt BA, Mucenski ML, Mason RJ, Shannon JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "16864775", "url": "https://glygen.org/publication/PubMed/16864775" } ] }, { "title": "A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.", "journal": "Nature cell biology", "date": "2006", "authors": "Choi SY, Huang P, Jenkins GM, Chan DC, Schiller J, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17028579", "url": "https://glygen.org/publication/PubMed/17028579" } ] }, { "title": "Structure and function of extracellular phospholipase A1 belonging to the pancreatic lipase gene family.", "journal": "Biochimie", "date": "2007", "authors": "Aoki J, Inoue A, Makide K, Saiki N, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "17101204", "url": "https://glygen.org/publication/PubMed/17101204" } ] }, { "title": "Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Cao J, Li JL, Li D, Tobin JF, Gimeno RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17170135", "url": "https://glygen.org/publication/PubMed/17170135" } ] }, { "title": "A single enzyme catalyzes both platelet-activating factor production and membrane biogenesis of inflammatory cells. Cloning and characterization of acetyl-CoA:LYSO-PAF acetyltransferase.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shindou H, Hishikawa D, Nakanishi H, Harayama T, Ishii S, Taguchi R, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "17182612", "url": "https://glygen.org/publication/PubMed/17182612" } ] }, { "title": "Role of 57-72 loop in the allosteric action of bile salts on pancreatic IB phospholipase A(2): regulation of fat and cholesterol homeostasis.", "journal": "Biochim. Biophys. Acta", "date": "2007", "authors": "Jain M.K., Yu B.Z., Apitz-Castro R.J., Berg O.G.", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "17603006", "url": "https://glygen.org/publication/PubMed/17603006" } ] }, { "title": "Topology of acyltransferase motifs and substrate specificity and accessibility in 1-acyl-sn-glycero-3-phosphate acyltransferase 1.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Yamashita A, Nakanishi H, Suzuki H, Kamata R, Tanaka K, Waku K, Sugiura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17707131", "url": "https://glygen.org/publication/PubMed/17707131" } ] }, { "title": "Caenorhabditis elegans mboa-7, a member of the MBOAT family, is required for selective incorporation of polyunsaturated fatty acids into phosphatidylinositol.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Lee HC, Inoue T, Imae R, Kono N, Shirae S, Matsuda S, Gengyo-Ando K, Mitani S, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482922" } ], "reference": [ { "type": "PubMed", "id": "18094042", "url": "https://glygen.org/publication/PubMed/18094042" } ] }, { "title": "Identification and characterization of a major liver lysophosphatidylcholine acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao Y, Chen YQ, Bonacci TM, Bredt DS, Li S, Bensch WR, Moller DE, Kowala M, Konrad RJ, Cao G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "18195019", "url": "https://glygen.org/publication/PubMed/18195019" } ] }, { "title": "AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen YQ, Kuo MS, Li S, Bui HH, Peake DA, Sanders PE, Thibodeaux SJ, Chu S, Qian YW, Zhao Y, Bredt DS, Moller DE, Konrad RJ, Beigneux AP, Young SG, Cao G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18238778", "url": "https://glygen.org/publication/PubMed/18238778" } ] }, { "title": "Discovery of a lysophospholipid acyltransferase family essential for membrane asymmetry and diversity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Hishikawa D, Shindou H, Kobayashi S, Nakanishi H, Taguchi R, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "18287005", "url": "https://glygen.org/publication/PubMed/18287005" } ] }, { "title": "Molecular identification of a novel mammalian brain isoform of acyl-CoA:lysophospholipid acyltransferase with prominent ethanolamine lysophospholipid acylating activity, LPEAT2.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cao J, Shan D, Revett T, Li D, Wu L, Liu W, Tobin JF, Gimeno RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "18458083", "url": "https://glygen.org/publication/PubMed/18458083" } ] }, { "title": "Identification and functional characterization of adipose-specific phospholipase A2 (AdPLA).", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Duncan RE, Sarkadi-Nagy E, Jaworski K, Ahmadian M, Sul HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "18614531", "url": "https://glygen.org/publication/PubMed/18614531" } ] }, { "title": "Acyl-CoA:lysophospholipid acyltransferases.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shindou H, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18718904", "url": "https://glygen.org/publication/PubMed/18718904" } ] }, { "title": "Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Gijon MA, Riekhof WR, Zarini S, Murphy RC, Voelker DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "18772128", "url": "https://glygen.org/publication/PubMed/18772128" } ] }, { "title": "Substrate preferences of a lysophosphatidylcholine acyltransferase highlight its role in phospholipid remodeling.", "journal": "Lipids", "date": "2008", "authors": "Kazachkov M, Chen Q, Wang L, Zou J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "18781350", "url": "https://glygen.org/publication/PubMed/18781350" } ] }, { "title": "The identification of a phospholipase B precursor in human neutrophils.", "journal": "The FEBS journal", "date": "2009", "authors": "Xu S, Zhao L, Larsson A, Venge P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482922", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482922" } ], "reference": [ { "type": "PubMed", "id": "19019078", "url": "https://glygen.org/publication/PubMed/19019078" } ] }, { "title": "A novel arachidonic acid-selective cytosolic PLA2 contains a Ca(2+)-dependent translocation domain with homology to PKC and GAP.", "journal": "Cell", "date": "1991", "authors": "Clark JD, Lin LL, Kriz RW, Ramesha CS, Sultzman LA, Lin AY, Milona N, Knopf JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "1904318", "url": "https://glygen.org/publication/PubMed/1904318" } ] }, { "title": "Structural insight into the activation mechanism of human pancreatic prophospholipase A2.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Xu W, Yi L, Feng Y, Chen L, Liu J", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "19297324", "url": "https://glygen.org/publication/PubMed/19297324" } ] }, { "title": "Biochemistry, physiology, and genetics of GPAT, AGPAT, and lipin enzymes in triglyceride synthesis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2009", "authors": "Takeuchi K, Reue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19336658", "url": "https://glygen.org/publication/PubMed/19336658" } ] }, { "title": "Characterization of human lysophospholipid acyltransferase 3.", "journal": "Journal of lipid research", "date": "2009", "authors": "Jain S, Zhang X, Khandelwal PJ, Saunders AJ, Cummings BS, Oelkers P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "19351971", "url": "https://glygen.org/publication/PubMed/19351971" } ] }, { "title": "Subcellular localization and lysophospholipase/transacylation activities of human group IVC phospholipase A2 (cPLA2gamma).", "journal": "Biochimica et biophysica acta", "date": "2009", "authors": "Yamashita A, Tanaka K, Kamata R, Kumazawa T, Suzuki N, Koga H, Waku K, Sugiura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "19501189", "url": "https://glygen.org/publication/PubMed/19501189" } ] }, { "title": "OSBPL10, a novel candidate gene for high triglyceride trait in dyslipidemic Finnish subjects, regulates cellular lipid metabolism.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2009", "authors": "Perttila J, Merikanto K, Naukkarinen J, Surakka I, Martin NW, Tanhuanpaa K, Grimard V, Taskinen MR, Thiele C, Salomaa V, Jula A, Perola M, Virtanen I, Peltonen L, Olkkonen VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "19554302", "url": "https://glygen.org/publication/PubMed/19554302" } ] }, { "title": "GPD1L links redox state to cardiac excitability by PKC-dependent phosphorylation of the sodium channel SCN5A.", "journal": "American journal of physiology. Heart and circulatory physiology", "date": "2009", "authors": "Valdivia CR, Ueda K, Ackerman MJ, Makielski JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19666841", "url": "https://glygen.org/publication/PubMed/19666841" } ] }, { "title": "A novel function of the human CLS1 in phosphatidylglycerol synthesis and remodeling.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Nie J, Hao X, Chen D, Han X, Chang Z, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "20025994", "url": "https://glygen.org/publication/PubMed/20025994" } ] }, { "title": "Interfacial kinetic and binding properties of mammalian group IVB phospholipase A2 (cPLA2beta) and comparison with the other cPLA2 isoforms.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ghomashchi F, Naika GS, Bollinger JG, Aloulou A, Lehr M, Leslie CC, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "20705608", "url": "https://glygen.org/publication/PubMed/20705608" } ] }, { "title": "Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.", "journal": "Journal of lipid research", "date": "2011", "authors": "Prasad SS, Garg A, Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "21173190", "url": "https://glygen.org/publication/PubMed/21173190" } ] }, { "title": "A role for oxysterol-binding protein-related protein 5 in endosomal cholesterol trafficking.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Du X, Kumar J, Ferguson C, Schulz TA, Ong YS, Hong W, Prinz WA, Parton RG, Brown AJ, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "21220512", "url": "https://glygen.org/publication/PubMed/21220512" } ] }, { "title": "Purification, identification, and cloning of lysoplasmalogenase, the enzyme that catalyzes hydrolysis of the vinyl ether bond of lysoplasmalogen.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu LC, Pfeiffer DR, Calhoon EA, Madiai F, Marcucci G, Liu S, Jurkowitz MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "21515882", "url": "https://glygen.org/publication/PubMed/21515882" } ] }, { "title": "Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Golczak M, Kiser PD, Sears AE, Lodowski DT, Blaner WS, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "22605381", "url": "https://glygen.org/publication/PubMed/22605381" } ] }, { "title": "Lysophospholipid acyltransferases: 1-acylglycerol-3-phosphate O-acyltransferases. From discovery to disease.", "journal": "Current opinion in lipidology", "date": "2012", "authors": "Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22777291", "url": "https://glygen.org/publication/PubMed/22777291" } ] }, { "title": "Generation of N-acylphosphatidylethanolamine by members of the phospholipase A/acyltransferase (PLA/AT) family.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Uyama T, Ikematsu N, Inoue M, Shinohara N, Jin XH, Tsuboi K, Tonai T, Tokumura A, Ueda N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "22825852", "url": "https://glygen.org/publication/PubMed/22825852" } ] }, { "title": "ORP10, a cholesterol binding protein associated with microtubules, regulates apolipoprotein B-100 secretion.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Nissila E, Ohsaki Y, Weber-Boyvat M, Perttila J, Ikonen E, Olkkonen VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "22906437", "url": "https://glygen.org/publication/PubMed/22906437" } ] }, { "title": "Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Inoue H, Baba T, Sato S, Ohtsuki R, Takemori A, Watanabe T, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22922100", "url": "https://glygen.org/publication/PubMed/22922100" } ] }, { "title": "Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Tesson C, Nawara M, Salih MA, Rossignol R, Zaki MS, Al Balwi M, Schule R, Mignot C, Obre E, Bouhouche A, Santorelli FM, Durand CM, Oteyza AC, El-Hachimi KH, Al Drees A, Bouslam N, Lamari F, Elmalik SA, Kabiraj MM, Seidahmed MZ, Esteves T, Gaussen M, Monin ML, Gyapay G, Lechner D, Gonzalez M, Depienne C, Mochel F, Lavie J, Schols L, Lacombe D, Yahyaoui M, Al Abdulkareem I, Zuchner S, Yamashita A, Benomar A, Goizet C, Durr A, Gleeson JG, Darios F, Brice A, Stevanin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176821", "url": "https://glygen.org/publication/PubMed/23176821" } ] }, { "title": "Mutations in DDHD2, encoding an intracellular phospholipase A(1), cause a recessive form of complex hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Schuurs-Hoeijmakers JH, Geraghty MT, Kamsteeg EJ, Ben-Salem S, de Bot ST, Nijhof B, van de Vondervoort II, van der Graaf M, Nobau AC, Otte-Holler I, Vermeer S, Smith AC, Humphreys P, Schwartzentruber J, Ali BR, Al-Yahyaee SA, Tariq S, Pramathan T, Bayoumi R, Kremer HP, van de Warrenburg BP, van den Akker WM, Gilissen C, Veltman JA, Janssen IM, Vulto-van Silfhout AT, van der Velde-Visser S, Lefeber DJ, Diekstra A, Erasmus CE, Willemsen MA, Vissers LE, Lammens M, van Bokhoven H, Brunner HG, Wevers RA, Schenck A, Al-Gazali L, de Vries BB, de Brouwer AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176823", "url": "https://glygen.org/publication/PubMed/23176823" } ] }, { "title": "Crystal structures and biochemical studies of human lysophosphatidic acid phosphatase type 6.", "journal": "Protein & cell", "date": "2013", "authors": "Li J, Dong Y, Lu X, Wang L, Peng W, Zhang XC, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23807634", "url": "https://glygen.org/publication/PubMed/23807634" } ] }, { "title": "Interactome map uncovers phosphatidylserine transport by oxysterol-binding proteins.", "journal": "Nature", "date": "2013", "authors": "Maeda K, Anand K, Chiapparino A, Kumar A, Poletto M, Kaksonen M, Gavin AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "23934110", "url": "https://glygen.org/publication/PubMed/23934110" } ] }, { "title": "Phospholipase A2G1B polymorphisms and risk of colorectal neoplasia.", "journal": "International journal of molecular epidemiology and genetics", "date": "2013", "authors": "Abbenhardt C, Poole EM, Kulmacz RJ, Xiao L, Curtin K, Galbraith RL, Duggan D, Hsu L, Makar KW, Caan BJ, Koepl L, Owen RW, Scherer D, Carlson CS, Potter JD, Slattery ML, Ulrich CM", "evidence": [ { "database": "Entrez", "id": "5319", "url": "https://www.ncbi.nlm.nih.gov/gene/5319" } ], "reference": [ { "type": "PubMed", "id": "24046806", "url": "https://glygen.org/publication/PubMed/24046806" } ] }, { "title": "Alkaline phosphatase: an overview.", "journal": "Indian journal of clinical biochemistry : IJCB", "date": "2014", "authors": "Sharma U, Pal D, Prasad R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "24966474", "url": "https://glygen.org/publication/PubMed/24966474" } ] }, { "title": "sPLA2 IB induces human podocyte apoptosis via the M-type phospholipase A2 receptor.", "journal": "Sci. Rep.", "date": "2014", "authors": "Pan Y, Wan J, Liu Y, Yang Q, Liang W, Singhal PC, Saleem MA, Ding G", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "25335547", "url": "https://glygen.org/publication/PubMed/25335547" } ] }, { "title": "INTRACELLULAR TRANSPORT. PI4P/phosphatidylserine countertransport at ORP5- and ORP8-mediated ER-plasma membrane contacts.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Chung J, Torta F, Masai K, Lucast L, Czapla H, Tanner LB, Narayanaswamy P, Wenk MR, Nakatsu F, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801" } ], "reference": [ { "type": "PubMed", "id": "26206935", "url": "https://glygen.org/publication/PubMed/26206935" } ] }, { "title": "Dysregulation of Plasmalogen Homeostasis Impairs Cholesterol Biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Honsho M, Abe Y, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "26463208", "url": "https://glygen.org/publication/PubMed/26463208" } ] }, { "title": "The HRASLS (PLA/AT) subfamily of enzymes.", "journal": "Journal of biomedical science", "date": "2015", "authors": "Mardian EB, Bradley RM, Duncan RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "26503625", "url": "https://glygen.org/publication/PubMed/26503625" } ] }, { "title": "Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.", "journal": "Molecular cell", "date": "2016", "authors": "Zhang Y, Liu X, Bai J, Tian X, Zhao X, Liu W, Duan X, Shang W, Fan HY, Tong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "26711011", "url": "https://glygen.org/publication/PubMed/26711011" } ] }, { "title": "Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Seilhamer JJ, Pruzanski W, Vadas P, Plant S, Miller JA, Kloss J, Johnson LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "2925608", "url": "https://glygen.org/publication/PubMed/2925608" } ] }, { "title": "Structure and properties of a human non-pancreatic phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Kramer RM, Hession C, Johansen B, Hayes G, McGray P, Chow EP, Tizard R, Pepinsky RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482839", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839" } ], "reference": [ { "type": "PubMed", "id": "2925633", "url": "https://glygen.org/publication/PubMed/2925633" } ] }, { "title": "Pancreatic phospholipase A2: isolation of the human gene and cDNAs from porcine pancreas and human lung.", "journal": "DNA", "date": "1986", "authors": "Seilhamer J.J., Yamanaka M., Johnson L.K., Randall T.L.", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "3028739", "url": "https://glygen.org/publication/PubMed/3028739" } ] }, { "title": "PLA2G1B is involved in CD4 anergy and CD4 lymphopenia in HIV-infected patients.", "journal": "The Journal of clinical investigation", "date": "2020", "authors": "Pothlichet J, Rose T, Bugault F, Jeammet L, Meola A, Haouz A, Saul F, Geny D, Alcami J, Ruiz-Mateos E, Teyton L, Lambeau G, Theze J", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ], "reference": [ { "type": "PubMed", "id": "32436864", "url": "https://glygen.org/publication/PubMed/32436864" } ] }, { "title": "sPLA2-IB Level Correlates with Hyperlipidemia and the Prognosis of Idiopathic Membranous Nephropathy.", "journal": "Current medical science", "date": "2020", "authors": "Yang LY, Wu YS, Dai BB, Lin SH, Chen H, Li GP, Tao X, Wan JX, Pan YB", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ], "reference": [ { "type": "PubMed", "id": "32862379", "url": "https://glygen.org/publication/PubMed/32862379" } ] }, { "title": "sPLA2-IB and PLA2R mediate insufficient autophagy and contribute to podocyte injury in idiopathic membranous nephropathy by activation of the p38MAPK/mTOR/ULK1(ser757) signaling pathway.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2021", "authors": "Yang L, Wu Y, Lin S, Dai B, Chen H, Tao X, Li G, Wan J, Pan Y", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ], "reference": [ { "type": "PubMed", "id": "33184968", "url": "https://glygen.org/publication/PubMed/33184968" } ] }, { "title": "Partial sequencing of human adult, human fetal, and bovine intestinal alkaline phosphatases: comparison with the human placental and liver isozymes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Hua JC, Berger J, Pan YC, Hulmes JD, Udenfriend S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "3458202", "url": "https://glygen.org/publication/PubMed/3458202" } ] }, { "title": "Genetic analysis of pancreatic phospholipase A2 (PLA2G1B) in patients with chronic pancreatitis.", "journal": "Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.]", "date": "2022", "authors": "Ewers M, Epple D, Bugert P, Rosendahl J, Witt H", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ], "reference": [ { "type": "PubMed", "id": "35031208", "url": "https://glygen.org/publication/PubMed/35031208" } ] }, { "title": "Microbial Protein Binding to gC1qR Drives PLA2G1B-Induced CD4 T-Cell Anergy.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Pothlichet J, Meola A, Bugault F, Jeammet L, Savitt AG, Ghebrehiwet B, Touqui L, Pouletty P, Fiore F, Sauvanet A, Theze J", "evidence": [ { "database": "RefSeq", "id": "NP_000919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000919" } ], "reference": [ { "type": "PubMed", "id": "35392090", "url": "https://glygen.org/publication/PubMed/35392090" } ] }, { "title": "The complete primary structure of phospholipase A2 from human pancreas.", "journal": "Biochim. Biophys. Acta", "date": "1983", "authors": "Verheij HM, Westerman J, Sternby B, De Haas GH", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "6349696", "url": "https://glygen.org/publication/PubMed/6349696" } ] }, { "title": "Studies on prophospholipase A2 and its enzyme from human pancreatic juice. Catalytic properties and sequence of the N-terminal region.", "journal": "Eur. J. Biochem.", "date": "1982", "authors": "Grataroli R, Dijkman R, Dutilh CE, van der Ouderaa F, De Haas GH, Figarella C", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" }, { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "7060561", "url": "https://glygen.org/publication/PubMed/7060561" } ] }, { "title": "The human 180-kDa receptor for secretory phospholipases A2. Molecular cloning, identification of a secreted soluble form, expression, and chromosomal localization.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Mattei M.-G., Lazdunski M., Lambeau G., Ancian P.", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "reference": [ { "type": "PubMed", "id": "7721806", "url": "https://glygen.org/publication/PubMed/7721806" } ] }, { "title": "The sequence of a human mitochondrial glycerol-3-phosphate dehydrogenase-encoding cDNA.", "journal": "Gene", "date": "1994", "authors": "Lehn DA, Brown LJ, Simonson GD, Moran SM, MacDonald MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "7821823", "url": "https://glygen.org/publication/PubMed/7821823" } ] }, { "title": "Serine 228 is essential for catalytic activities of 85-kDa cytosolic phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Sharp JD, Pickard RT, Chiou XG, Manetta JV, Kovacevic S, Miller JR, Varshavsky AD, Roberts EF, Strifler BA, Brems DN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "8083230", "url": "https://glygen.org/publication/PubMed/8083230" } ] }, { "title": "Enzymatic, metabolic and secretory patterns in human islets of type 2 (non-insulin-dependent) diabetic patients.", "journal": "Diabetologia", "date": "1994", "authors": "Fernandez-Alvarez J, Conget I, Rasschaert J, Sener A, Gomis R, Malaisse WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8163052", "url": "https://glygen.org/publication/PubMed/8163052" } ] }, { "title": "Purification of peroxisomal acyl-CoA: dihydroxyacetonephosphate acyltransferase from human placenta.", "journal": "Biochimica et biophysica acta", "date": "1994", "authors": "Ofman R, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8186247", "url": "https://glygen.org/publication/PubMed/8186247" } ] }, { "title": "Cloning and recombinant expression of a novel human low molecular weight Ca(2+)-dependent phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Chen J, Engle SJ, Seilhamer JJ, Tischfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "8300559", "url": "https://glygen.org/publication/PubMed/8300559" } ] }, { "title": "Human ADP-ribosylation factor-activated phosphatidylcholine-specific phospholipase D defines a new and highly conserved gene family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Hammond SM, Altshuller YM, Sung TC, Rudge SA, Rose K, Engebrecht J, Morris AJ, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8530346", "url": "https://glygen.org/publication/PubMed/8530346" } ] }, { "title": "Molecular cloning of human mitochondrial glycerophosphate dehydrogenase gene: genomic structure, chromosomal localization, and existence of a pseudogene.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Matsutani A, Takeuchi Y, Ishihara H, Kuwano S, Oka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8687421", "url": "https://glygen.org/publication/PubMed/8687421" } ] }, { "title": "Cloning, chromosomal mapping, and expression of a novel human secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cupillard L, Koumanov K, Mattei MG, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482925", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925" } ], "reference": [ { "type": "PubMed", "id": "9188469", "url": "https://glygen.org/publication/PubMed/9188469" } ] }, { "title": "Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells.", "journal": "DNA and cell biology", "date": "1997", "authors": "West J, Tompkins CK, Balantac N, Nudelman E, Meengs B, White T, Bursten S, Coleman J, Kumar A, Singer JW, Leung DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9212163", "url": "https://glygen.org/publication/PubMed/9212163" } ] }, { "title": "Multiple splice variants of the human calcium-independent phospholipase A2 and their effect on enzyme activity.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Larsson PK, Claesson HE, Kennedy BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "9417066", "url": "https://glygen.org/publication/PubMed/9417066" } ] }, { "title": "Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Aguado B, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9461603", "url": "https://glygen.org/publication/PubMed/9461603" } ] }, { "title": "Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lopez I, Arnold RS, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9582313", "url": "https://glygen.org/publication/PubMed/9582313" } ] }, { "title": "A novel calcium-independent phospholipase A2, cPLA2-gamma, that is prenylated and contains homology to cPLA2.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Underwood KW, Song C, Kriz RW, Chang XJ, Knopf JL, Lin LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1482788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788" } ], "reference": [ { "type": "PubMed", "id": "9705332", "url": "https://glygen.org/publication/PubMed/9705332" } ] } ], "pathway": [ { "id": "hsa:5319", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5319", "resource": "KEGG Pathway" }, { "id": "R-HSA-1482788", "name": "Acyl chain remodelling of PC", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482788", "resource": "Reactome", "description": "Acyl chain remodelling of PC" }, { "id": "R-HSA-1482801", "name": "Acyl chain remodelling of PS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482801", "resource": "Reactome", "description": "Acyl chain remodelling of PS" }, { "id": "R-HSA-1482839", "name": "Acyl chain remodelling of PE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482839", "resource": "Reactome", "description": "Acyl chain remodelling of PE" }, { "id": "R-HSA-1482922", "name": "Acyl chain remodelling of PI", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482922", "resource": "Reactome", "description": "Acyl chain remodelling of PI" }, { "id": "R-HSA-1482925", "name": "Acyl chain remodelling of PG", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1482925", "resource": "Reactome", "description": "Acyl chain remodelling of PG" }, { "id": "R-HSA-1483166", "name": "Synthesis of PA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "resource": "Reactome", "description": "Synthesis of PA" } ], "orthologs": [ { "uniprot_canonical_ac": "P04055-1", "protein_name": "Phospholipase A2", "gene_name": "Pla2g1b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLDRCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICFSKVPYNKEYKDLDTKKHC", "length": 146 }, "evidence": [ { "id": "45228792", "url": "http://www.informatics.jax.org/homology/45228792", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z0Y2-1", "protein_name": "Phospholipase A2", "gene_name": "Pla2g1b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKLLLLAALLTAGAAAHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC", "length": 146 }, "evidence": [ { "id": "45228792", "url": "http://www.informatics.jax.org/homology/45228792", "database": "MGI" }, { "id": "P04054", "url": "https://omabrowser.org/oma/group/P04054/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 29, "go_terms": [ { "name": "lipid catabolic process", "id": "GO:0016042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016042", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "arachidonic acid secretion", "id": "GO:0050482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050482", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "phosphatidylcholine metabolic process", "id": "GO:0046470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046470", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "neutrophil mediated immunity", "id": "GO:0002446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002446", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "fatty acid biosynthetic process", "id": "GO:0006633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006633", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "regulation of glucose import", "id": "GO:0046324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046324", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of protein secretion", "id": "GO:0050714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050714", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "activation of phospholipase A2 activity", "id": "GO:0032431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032431", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "innate immune response in mucosa", "id": "GO:0002227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002227", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "leukotriene biosynthetic process", "id": "GO:0019370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019370", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "phospholipid metabolic process", "id": "GO:0006644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006644", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of calcium ion transport into cytosol", "id": "GO:0010524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010524", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of immune response", "id": "GO:0050778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050778", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "positive regulation of podocyte apoptotic process", "id": "GO:1904635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904635", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "phosphatidylglycerol metabolic process", "id": "GO:0046471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046471", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "neutrophil chemotaxis", "id": "GO:0030593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "phospholipase A2 activity", "id": "GO:0004623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004623", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "calcium-dependent phospholipase A2 activity", "id": "GO:0047498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047498", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "phospholipid binding", "id": "GO:0005543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" }, { "name": "bile acid binding", "id": "GO:0032052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032052", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically.", "evidence": [ { "database": "UniProtKB", "id": "P04054", "url": "https://www.uniprot.org/uniprot/P04054" }, { "database": "PubMed", "id": "6349696", "url": "https://glygen.org/publication/PubMed/6349696" }, { "database": "PubMed", "id": "19297324", "url": "https://glygen.org/publication/PubMed/19297324" } ] } ], "interactions": [], "reactions": [ { "id": "15801", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P97570-1", "P39878-1", "O54728-1", "P04055-1", "P50393-1", "P53817-1", "O35244-1", "P51433-1", "Q9QZT3-1", "P14423-1", "D3Z9B7-1", "D3ZLB5-1", "D4A1I6-1", "D3ZQH6-1", "F1LPY6-1", "D3ZRC4-1", "Q675A5-1", "D2KX21-1", "Q4KLN5-1", "F7F420-1", "P0C548-1", "P0C869-1", "Q9BZM1-1", "Q8WU67-1", "P14555-1", "P04054-1", "Q9HDD0-1", "Q9UL19-1", "Q9NWW9-1", "Q96KN8-1", "P47712-1", "Q68DD2-1", "Q9NZ20-1", "Q3MJ16-3", "Q9BZM2-1", "P53816-1", "O15496-1", "O60733-1", "Q6P1J6-1", "Q9UNK4-1", "P30041-1", "Q86XP0-1", "Q9UP65-1", "P39877-1", "Q9NZK7-1", "Q5R387-1", "Q9HCN3-1", "Q8NCC3-1", "Q9NP80-1", "Q9NST1-1", "Q96AD5-1", "P41247-1", "P0C871-1", "O08709-1", "Q91ZH7-1", "Q9CPX5-1", "Q9QZU4-1", "Q8R3U1-1", "P31482-1", "P47713-1", "Q9WVF6-1", "Q9Z0Y2-1", "P48076-1", "Q9EPR2-1", "P97391-1", "P97819-1", "Q50L41-1", "Q50L42-1", "Q50L43-1", "Q3TTY0-1", "Q64GA5-1", "Q9QUL3-1", "Q9QXX3-1", "Q9QZT4-1", "Q9ESN3-1", "Q8K1N1-1", "Q8VEB4-1", "Q8BZT7-1", "Q91WW7-1", "Q8BJ56-1", "Q8BG37-1", "Q08448-1", "Q7KUD4-1", "Q8IML0-1", "Q9VMM8-1" ], "evidence": [ { "id": "15801", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15801" } ] }, { "id": "38779", "name": "", "equation": "1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine + H2O = (9Z)-octadecenoate + 1-hexadecanoyl-sn-glycero-3-phosphocholine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P53817-1", "P97570-1", "O54728-1", "P04055-1", "P51433-1", "Q675A5-1", "Q9QZT3-1", "P14423-1", "D3ZRC4-1", "Q9UL19-1", "Q9NWW9-1", "P53816-1", "Q86XP0-1", "Q9BZM2-1", "Q6P1J6-1", "O60733-1", "Q9UNK4-1", "P14555-1", "P04054-1", "Q8NCC3-1", "O15496-1", "Q9UP65-1", "P39877-1", "Q9NZK7-1", "Q9NP80-1", "Q8R3U1-1", "Q50L43-1", "Q9QZT4-1", "Q8VEB4-1", "Q8K1N1-1", "P31482-1", "Q9WVF6-1", "Q9Z0Y2-1", "P97391-1", "P97819-1", "Q3TTY0-1", "Q9QUL3-1", "Q9QXX3-1", "Q64GA5-1", "Q9VMM8-1" ], "evidence": [ { "id": "38779", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38779" } ] }, { "id": "40427", "name": "", "equation": "1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphocholine + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + 1-hexadecanoyl-sn-glycero-3-phosphocholine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P53817-1", "P97570-1", "D3ZRC4-1", "P04055-1", "P50393-1", "P18424-1", "P51433-1", "D3Z9B7-1", "D4A1I6-1", "D3ZQH6-1", "F1LPY6-1", "P53816-1", "Q86XP0-1", "P0C869-1", "P04180-1", "O60733-1", "P47712-1", "Q68DD2-1", "Q9NZ20-1", "P04054-1", "Q3MJ16-3", "Q9UP65-1", "P39877-1", "Q9NP80-1", "P47713-1", "P0C871-1", "Q8R3U1-1", "Q50L43-1", "Q8K1N1-1", "Q9Z0Y2-1", "P97391-1", "P97819-1", "Q50L41-1", "Q50L42-1", "Q8BZT7-1", "P16301-1", "Q64GA5-1" ], "evidence": [ { "id": "40427", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40427" } ] }, { "id": "40815", "name": "", "equation": "1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine + H2O = (9Z,12Z)-octadecadienoate + 1-hexadecanoyl-sn-glycero-3-phosphoethanolamine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P53817-1", "P04055-1", "P51433-1", "Q9QZT3-1", "P14423-1", "Q9UL19-1", "Q9NWW9-1", "P53816-1", "Q86XP0-1", "P0C869-1", "Q9BZM2-1", "Q68DD2-1", "Q9NZ20-1", "Q9UNK4-1", "P14555-1", "P04054-1", "O15496-1", "P39877-1", "Q9NZK7-1", "Q8R3U1-1", "Q50L43-1", "Q9QZT4-1", "P31482-1", "Q9WVF6-1", "Q9Z0Y2-1", "P97391-1", "Q50L41-1", "Q9QUL3-1", "Q9QXX3-1", "Q8BZT7-1" ], "evidence": [ { "id": "40815", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40815" } ] }, { "id": "40919", "name": "", "equation": "1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phospho-(1'-sn-glycerol) + H2O = (9Z)-octadecenoate + 1-hexadecanoyl-sn-glycero-3-phospho-(1'-sn-glycerol) + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6MG55-1", "O54728-1", "P04055-1", "P14423-1", "O95870-1", "Q9BZM2-1", "Q6P1J6-1", "Q9UNK4-1", "P14555-1", "P04054-1", "Q9Z1Q2-1", "Q9QZT4-1", "P31482-1", "Q9WVF6-1", "Q9Z0Y2-1", "Q3TTY0-1", "Q9VMM8-1" ], "evidence": [ { "id": "40919", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40919" } ] }, { "id": "41223", "name": "", "equation": "1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + H2O = 1-hexadecanoyl-sn-glycero-3-phosphocholine + H(+) + hexadecanoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P53817-1", "P97570-1", "O54728-1", "P04055-1", "O35244-1", "Q9QZT3-1", "P14423-1", "D2KX21-1", "Q9HDD0-1", "Q9UL19-1", "Q9NWW9-1", "P53816-1", "Q6P1J6-1", "O60733-1", "Q9UNK4-1", "P14555-1", "P04054-1", "O15496-1", "Q9UP65-1", "Q9NZK7-1", "P30041-1", "O08709-1", "Q9QZU4-1", "Q8R3U1-1", "P31482-1", "Q9WVF6-1", "Q9Z0Y2-1", "P97819-1", "Q3TTY0-1", "Q9QUL3-1", "Q9QXX3-1", "Q64GA5-1", "Q8BG37-1", "P39105-1", "P36165-1", "Q03674-1", "Q9VMM8-1" ], "evidence": [ { "id": "41223", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41223" } ] }, { "id": "45424", "name": "", "equation": "H2O + N-hexadecanoyl-1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine = (9Z)-octadecenoate + H(+) + N-hexadecanoyl-1-(9Z-octadecenoyl)-sn-glycero-3-phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04055-1", "P51433-1", "P14423-1", "Q8TB40-1", "P14555-1", "P04054-1", "P39877-1", "Q8VD66-1", "P31482-1", "Q9Z0Y2-1", "P97391-1" ], "evidence": [ { "id": "45424", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/45424" } ] }, { "id": "54456", "name": "", "equation": "1,2-ditetradecanoyl-sn-glycero-3-phosphocholine + H2O = 1-tetradecanoyl-sn-glycero-3-phosphocholine + H(+) + tetradecanoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04055-1", "Q8WU67-1", "P04054-1", "Q91ZH7-1", "Q9Z0Y2-1" ], "evidence": [ { "id": "54456", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54456" } ] }, { "id": "56424", "name": "", "equation": "H2O + N,1-dihexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphoethanolamine = (9Z,12Z)-octadecadienoate + H(+) + N,1-dihexadecanoyl-sn-glycero-3-phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04055-1", "P04054-1", "Q9Z0Y2-1" ], "evidence": [ { "id": "56424", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56424" } ] }, { "id": "R-HSA-1602368", "name": "PG is hydrolyzed to 1-acyl LPG by PLA2[16]", "equation": "", "summary": "At the plasma membrane, phosphatidylglycerol (PG) is hydrolyzed, removing one of its acyl groups, to 1-acyl lysophosphatidylglycerol (LPG) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Group III (PLA2G3) (Murakami et al. 2003, Murakami et al. 2005); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-1602402" ], "output_participant_list": [ "R-ALL-1602415" ], "enzyme_list": [ "Q9NZ20-1", "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602368", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602368" } ] }, { "id": "R-HSA-1602374", "name": "PS is hydrolyzed to 1-acyl LPS by PLA2[15]", "equation": "", "summary": "At the plasma membrane, phosphatidylserine (PS) is hydrolyzed, removing one of its acyl groups, to 1-acyl lysophosphatidylserine (LPS) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1602419" ], "enzyme_list": [ "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602374", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602374" } ] }, { "id": "R-HSA-1602377", "name": "PI is hydrolyzed to 1-acyl LPI by PLA2[15]", "equation": "", "summary": "At the plasma membrane, phosphatidylinositol (PI) is hydrolyzed, removing one of its acyl groups, to 1-acyl lysophosphatidylinositol (LPI) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1602420" ], "enzyme_list": [ "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602377", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602377" } ] }, { "id": "R-HSA-1602398", "name": "PE is hydrolyzed to 1-acyl LPE by PLA2[16]", "equation": "", "summary": "At the plasma membrane, phosphatidylethanolamine (PE) is hydrolyzed, removing one of its acyl groups, to 1-acyl phosphatidylethanolamine (LPE) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Group III (PLA2G3) (Murakami et al. 2003, Murakami et al. 2005); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [ "R-ALL-1602375" ], "output_participant_list": [ "R-ALL-1602372" ], "enzyme_list": [ "Q9NZ20-1", "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602398", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602398" } ] }, { "id": "R-HSA-1602417", "name": "PC is hydrolyzed to 1-acyl LPC by PLA2[16]", "equation": "", "summary": "At the plasma membrane, phosphatidylcholine (PC) is hydrolyzed, removing one of its acyl groups, to 1-acyl lysophosphatidylcholine (LPC) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Group III (PLA2G3) (Murakami et al. 2003, Murakami et al. 2005); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9NZ20-1", "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602417", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602417" } ] }, { "id": "R-HSA-1602446", "name": "PA is hydrolyzed to 1-acyl LPA by PLA2[15]", "equation": "", "summary": "At the plasma membrane, phosphatidic acid (PA) is hydrolyzed, removing one of its acyl groups, to 1-acyl lysophosphatidic acid (LPA) by secretory phospholipase A2 proteins (Singer et al. 2002, Ishizaki et al. 1999). These include: Group IB (PLA2G1B) (Grataroli et al. 1982); Group IIA (PLA2G2A) (Seilhamer et al. 1989); Group IID (PLA2G2D) (Ishizaki et al. 1999); Group IIE (PLA2G2E) (Suzuki et al. 2000); Group IIF (PLA2G2F) (Valentin et al. 2000); Calcium-dependent Group V (PLA2G5) (Chen et al. 1994); Group X (PLA2G10) (Cupillard et al. 1997, Pan et al. 2002); and Group XIIA (PLA2G12A) (Gelb et al. 2000, Murakami et al. 2003).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-1602366", "R-ALL-1602447" ], "enzyme_list": [ "O15496-1", "P14555-1", "Q9BZM2-1", "P04054-1", "P39877-1", "Q9BZM1-1", "Q9NZK7-1", "Q9UNK4-1" ], "evidence": [ { "id": "R-HSA-1602446", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602446" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1602366", "participant_name": "LCFA(-) [plasma membrane]", "crossref": [ { "id": "C00060", "database": "COMPOUND", "url": "" }, { "id": "57560", "database": "ChEBI", "url": "" }, { "id": "C00060", "database": "COMPOUND", "url": "" }, { "id": "57560", "database": "ChEBI", "url": "" }, { "id": "57560", "database": "ChEBI", "url": "" }, { "id": "C00060", "database": "COMPOUND", "url": "" }, { "id": "C00060", "database": "COMPOUND", "url": "" }, { "id": "57560", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602372", "participant_name": "1-acyl LPE [plasma membrane]", "crossref": [ { "id": "C04438", "database": "COMPOUND", "url": "" }, { "id": "29017", "database": "ChEBI", "url": "" }, { "id": "000013514281", "database": "ZINC", "url": "" }, { "id": "C04438", "database": "COMPOUND", "url": "" }, { "id": "29017", "database": "ChEBI", "url": "" }, { "id": "000013514281", "database": "ZINC", "url": "" }, { "id": "C04438", "database": "COMPOUND", "url": "" }, { "id": "000013514281", "database": "ZINC", "url": "" }, { "id": "29017", "database": "ChEBI", "url": "" }, { "id": "C04438", "database": "COMPOUND", "url": "" }, { "id": "29017", "database": "ChEBI", "url": "" }, { "id": "000013514281", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-1602375", "participant_name": "PE [plasma membrane]", "crossref": [ { "id": "57613", "database": "ChEBI", "url": "" }, { "id": "57613", "database": "ChEBI", "url": "" }, { "id": "57613", "database": "ChEBI", "url": "" }, { "id": "57613", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602402", "participant_name": "PG [plasma membrane]", "crossref": [ { "id": "64716", "database": "ChEBI", "url": "" }, { "id": "64716", "database": "ChEBI", "url": "" }, { "id": "64716", "database": "ChEBI", "url": "" }, { "id": "64716", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602415", "participant_name": "1-acyl LPG [plasma membrane]", "crossref": [ { "id": "C18126", "database": "COMPOUND", "url": "" }, { "id": "62747", "database": "ChEBI", "url": "" }, { "id": "C18126", "database": "COMPOUND", "url": "" }, { "id": "62747", "database": "ChEBI", "url": "" }, { "id": "62747", "database": "ChEBI", "url": "" }, { "id": "C18126", "database": "COMPOUND", "url": "" }, { "id": "C18126", "database": "COMPOUND", "url": "" }, { "id": "62747", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602419", "participant_name": "1-acyl LPS [plasma membrane]", "crossref": [ { "id": "C18125", "database": "COMPOUND", "url": "" }, { "id": "52603", "database": "ChEBI", "url": "" }, { "id": "C18125", "database": "COMPOUND", "url": "" }, { "id": "52603", "database": "ChEBI", "url": "" }, { "id": "52603", "database": "ChEBI", "url": "" }, { "id": "C18125", "database": "COMPOUND", "url": "" }, { "id": "C18125", "database": "COMPOUND", "url": "" }, { "id": "52603", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602420", "participant_name": "1-acyl LPI [plasma membrane]", "crossref": [ { "id": "C03819", "database": "COMPOUND", "url": "" }, { "id": "28914", "database": "ChEBI", "url": "" }, { "id": "C03819", "database": "COMPOUND", "url": "" }, { "id": "28914", "database": "ChEBI", "url": "" }, { "id": "28914", "database": "ChEBI", "url": "" }, { "id": "C03819", "database": "COMPOUND", "url": "" }, { "id": "C03819", "database": "COMPOUND", "url": "" }, { "id": "28914", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-1602447", "participant_name": "1-acyl LPA [plasma membrane]", "crossref": [ { "id": "C00681", "database": "COMPOUND", "url": "" }, { "id": "16975", "database": "ChEBI", "url": "" }, { "id": "C00681", "database": "COMPOUND", "url": "" }, { "id": "16975", "database": "ChEBI", "url": "" }, { "id": "C00681", "database": "COMPOUND", "url": "" }, { "id": "16975", "database": "ChEBI", "url": "" }, { "id": "C00681", "database": "COMPOUND", "url": "" }, { "id": "16975", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "D2KX21", "gene_name": "Plaat1", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D2KX21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D2KX21" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D2KX21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D2KX21" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "D2KX21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D2KX21" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D2KX21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D2KX21" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "D2KX21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D2KX21" } ] } ] }, { "uniprot_ac": "D3Z9B7", "gene_name": "Pla2g4f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D3Z9B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9B7" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D3Z9B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9B7" } ] } ] }, { "uniprot_ac": "D3ZLB5", "gene_name": "Pla2g2f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D3ZLB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLB5" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D3ZLB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLB5" } ] } ] }, { "uniprot_ac": "D3ZQH6", "gene_name": "Pla2g4d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D3ZQH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQH6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D3ZQH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQH6" } ] } ] }, { "uniprot_ac": "D3ZRC4", "gene_name": "Pnpla8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] } ] }, { "uniprot_ac": "D4A1I6", "gene_name": "Pla2g4b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D4A1I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1I6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D4A1I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1I6" } ] } ] }, { "uniprot_ac": "F1LPY6", "gene_name": "Pla2g4e", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "F1LPY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPY6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "F1LPY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPY6" } ] } ] }, { "uniprot_ac": "F7F420", "gene_name": "Pla2g2d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "F7F420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F420" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "F7F420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F420" } ] } ] }, { "uniprot_ac": "O08709", "gene_name": "Prdx6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "O08709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08709" } ] } ] }, { "uniprot_ac": "O15496", "gene_name": "PLA2G10", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O15496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15496" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "O15496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15496" } ] } ] }, { "uniprot_ac": "O35244", "gene_name": "Prdx6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "O35244", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35244" } ] } ] }, { "uniprot_ac": "O54728", "gene_name": "Plb1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] } ] }, { "uniprot_ac": "O60733", "gene_name": "PLA2G6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] } ] }, { "uniprot_ac": "O95870", "gene_name": "ABHD16A", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "O95870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95870" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "O95870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95870" } ] } ] }, { "uniprot_ac": "P04054", "gene_name": "PLA2G1B", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P04054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04054" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P04054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04054" } ] } ] }, { "uniprot_ac": "P04055", "gene_name": "Pla2g1b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P04055", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04055" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P04055", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04055" } ] } ] }, { "uniprot_ac": "P04180", "gene_name": "LCAT", "activity": [ { "ec_number": "2.3.1.43", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + a sterol = a 1-acyl-sn-glycero-3-phosphocholine + a sterol ester.", "evidence": [ { "id": "P04180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04180" } ] }, { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "P04180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04180" } ] }, { "ec_number": "2.3.1.43", "activity": "", "evidence": [ { "id": "P04180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04180" } ] } ] }, { "uniprot_ac": "P0C548", "gene_name": "Pnpla2", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P0C548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C548" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P0C548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C548" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P0C548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C548" } ] } ] }, { "uniprot_ac": "P0C869", "gene_name": "PLA2G4B", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] } ] }, { "uniprot_ac": "P0C871", "gene_name": "Pla2g4b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] } ] }, { "uniprot_ac": "P14423", "gene_name": "Pla2g2a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P14423", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14423" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P14423", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14423" } ] } ] }, { "uniprot_ac": "P14555", "gene_name": "PLA2G2A", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P14555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14555" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P14555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14555" } ] } ] }, { "uniprot_ac": "P16301", "gene_name": "Lcat", "activity": [ { "ec_number": "2.3.1.43", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + a sterol = a 1-acyl-sn-glycero-3-phosphocholine + a sterol ester.", "evidence": [ { "id": "P16301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16301" } ] }, { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "P16301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16301" } ] }, { "ec_number": "2.3.1.43", "activity": "", "evidence": [ { "id": "P16301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16301" } ] } ] }, { "uniprot_ac": "P18424", "gene_name": "Lcat", "activity": [ { "ec_number": "2.3.1.43", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + a sterol = a 1-acyl-sn-glycero-3-phosphocholine + a sterol ester.", "evidence": [ { "id": "P18424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18424" } ] }, { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "P18424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18424" } ] }, { "ec_number": "2.3.1.43", "activity": "", "evidence": [ { "id": "P18424", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18424" } ] } ] }, { "uniprot_ac": "P30041", "gene_name": "PRDX6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] } ] }, { "uniprot_ac": "P31482", "gene_name": "Pla2g2a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P31482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31482" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P31482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31482" } ] } ] }, { "uniprot_ac": "P36165", "gene_name": "TGL4", "activity": [ { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P36165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36165" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P36165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36165" } ] } ] }, { "uniprot_ac": "P39105", "gene_name": "PLB1", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P39105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39105" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "P39105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39105" } ] } ] }, { "uniprot_ac": "P39877", "gene_name": "PLA2G5", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P39877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39877" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P39877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39877" } ] } ] }, { "uniprot_ac": "P39878", "gene_name": "Pla2g2c", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P39878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39878" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P39878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39878" } ] } ] }, { "uniprot_ac": "P41247", "gene_name": "PNPLA4", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P41247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41247" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P41247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41247" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P41247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41247" } ] } ] }, { "uniprot_ac": "P47712", "gene_name": "PLA2G4A", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P47712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47712" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P47712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47712" } ] } ] }, { "uniprot_ac": "P47713", "gene_name": "Pla2g4a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] } ] }, { "uniprot_ac": "P48076", "gene_name": "Pla2g2c", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P48076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48076" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P48076", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48076" } ] } ] }, { "uniprot_ac": "P50393", "gene_name": "Pla2g4a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] } ] }, { "uniprot_ac": "P51433", "gene_name": "Pla2g5", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P51433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51433" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P51433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51433" } ] } ] }, { "uniprot_ac": "P53816", "gene_name": "PLAAT3", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P53816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53816" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P53816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53816" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P53816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53816" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "P53816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53816" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P53816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53816" } ] } ] }, { "uniprot_ac": "P53817", "gene_name": "Plaat3", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P53817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53817" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P53817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53817" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P53817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53817" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P53817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53817" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "P53817", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53817" } ] } ] }, { "uniprot_ac": "P97391", "gene_name": "Pla2g5", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P97391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97391" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P97391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97391" } ] } ] }, { "uniprot_ac": "P97570", "gene_name": "Pla2g6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] } ] }, { "uniprot_ac": "P97819", "gene_name": "Pla2g6", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] } ] }, { "uniprot_ac": "Q03674", "gene_name": "PLB2", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q03674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03674" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q03674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03674" } ] } ] }, { "uniprot_ac": "Q08448", "gene_name": "LPL1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q08448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08448" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q08448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08448" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q08448", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08448" } ] } ] }, { "uniprot_ac": "Q3MJ16", "gene_name": "PLA2G4E", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q3MJ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJ16" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q3MJ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJ16" } ] } ] }, { "uniprot_ac": "Q3TTY0", "gene_name": "Plb1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] } ] }, { "uniprot_ac": "Q4KLN5", "gene_name": "Plaat5", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q4KLN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KLN5" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q4KLN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KLN5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q4KLN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KLN5" } ] } ] }, { "uniprot_ac": "Q50L41", "gene_name": "Pla2g4f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L41" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L41" } ] } ] }, { "uniprot_ac": "Q50L42", "gene_name": "Pla2g4e", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L42" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L42" } ] } ] }, { "uniprot_ac": "Q50L43", "gene_name": "Pla2g4d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L43" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L43" } ] } ] }, { "uniprot_ac": "Q5R387", "gene_name": "PLA2G2C", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q5R387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5R387" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q5R387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5R387" } ] } ] }, { "uniprot_ac": "Q64GA5", "gene_name": "Pla2g4c", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] } ] }, { "uniprot_ac": "Q675A5", "gene_name": "Pla2g15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] } ] }, { "uniprot_ac": "Q68DD2", "gene_name": "PLA2G4F", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q68DD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68DD2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q68DD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68DD2" } ] } ] }, { "uniprot_ac": "Q6MG55", "gene_name": "Abhd16a", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q6MG55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MG55" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q6MG55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MG55" } ] } ] }, { "uniprot_ac": "Q6P1J6", "gene_name": "PLB1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] } ] }, { "uniprot_ac": "Q7KUD4", "gene_name": "iPLA2-VIA", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q7KUD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KUD4" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q7KUD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KUD4" } ] } ] }, { "uniprot_ac": "Q86XP0", "gene_name": "PLA2G4D", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q86XP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XP0" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q86XP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XP0" } ] } ] }, { "uniprot_ac": "Q8BG37", "gene_name": "Prdx6b", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "Q8BG37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG37" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "Q8BG37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BG37" } ] } ] }, { "uniprot_ac": "Q8BJ56", "gene_name": "Pnpla2", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8BJ56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJ56" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q8BJ56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJ56" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q8BJ56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJ56" } ] } ] }, { "uniprot_ac": "Q8BZT7", "gene_name": "Pla2g3", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8BZT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT7" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8BZT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT7" } ] } ] }, { "uniprot_ac": "Q8IML0", "gene_name": "Dmel\\CG14507", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8IML0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IML0" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8IML0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IML0" } ] } ] }, { "uniprot_ac": "Q8K1N1", "gene_name": "Pnpla8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] } ] }, { "uniprot_ac": "Q8NCC3", "gene_name": "PLA2G15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] } ] }, { "uniprot_ac": "Q8R3U1", "gene_name": "Plaat3", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8R3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3U1" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8R3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3U1" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8R3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3U1" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q8R3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3U1" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8R3U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3U1" } ] } ] }, { "uniprot_ac": "Q8TB40", "gene_name": "ABHD4", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q8TB40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TB40" } ] } ] }, { "uniprot_ac": "Q8VD66", "gene_name": "Abhd4", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q8VD66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VD66" } ] } ] }, { "uniprot_ac": "Q8VEB4", "gene_name": "Pla2g15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] } ] }, { "uniprot_ac": "Q8WU67", "gene_name": "ABHD3", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8WU67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU67" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8WU67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU67" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q8WU67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU67" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8WU67", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WU67" } ] } ] }, { "uniprot_ac": "Q91WW7", "gene_name": "Pnpla3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] } ] }, { "uniprot_ac": "Q91ZH7", "gene_name": "Abhd3", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q91ZH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZH7" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q91ZH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZH7" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q91ZH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZH7" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q91ZH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZH7" } ] } ] }, { "uniprot_ac": "Q96AD5", "gene_name": "PNPLA2", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q96AD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AD5" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q96AD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AD5" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q96AD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96AD5" } ] } ] }, { "uniprot_ac": "Q96KN8", "gene_name": "PLAAT5", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q96KN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96KN8" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q96KN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96KN8" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q96KN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96KN8" } ] } ] }, { "uniprot_ac": "Q9BZM1", "gene_name": "PLA2G12A", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9BZM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZM1" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9BZM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZM1" } ] } ] }, { "uniprot_ac": "Q9BZM2", "gene_name": "PLA2G2F", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9BZM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZM2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9BZM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BZM2" } ] } ] }, { "uniprot_ac": "Q9CPX5", "gene_name": "Plaat5", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9CPX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPX5" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9CPX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPX5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9CPX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPX5" } ] } ] }, { "uniprot_ac": "Q9EPR2", "gene_name": "Pla2g12a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9EPR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPR2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9EPR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EPR2" } ] } ] }, { "uniprot_ac": "Q9ESN3", "gene_name": "Pgap6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9ESN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESN3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9ESN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESN3" } ] } ] }, { "uniprot_ac": "Q9HCN3", "gene_name": "PGAP6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9HCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCN3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9HCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCN3" } ] } ] }, { "uniprot_ac": "Q9HDD0", "gene_name": "PLAAT1", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9HDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HDD0" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9HDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HDD0" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9HDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HDD0" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9HDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HDD0" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q9HDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HDD0" } ] } ] }, { "uniprot_ac": "Q9NP80", "gene_name": "PNPLA8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] } ] }, { "uniprot_ac": "Q9NST1", "gene_name": "PNPLA3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] } ] }, { "uniprot_ac": "Q9NWW9", "gene_name": "PLAAT2", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWW9" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWW9" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9NWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWW9" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q9NWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWW9" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9NWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NWW9" } ] } ] }, { "uniprot_ac": "Q9NZ20", "gene_name": "PLA2G3", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NZ20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZ20" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9NZ20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZ20" } ] } ] }, { "uniprot_ac": "Q9NZK7", "gene_name": "PLA2G2E", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NZK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZK7" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9NZK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NZK7" } ] } ] }, { "uniprot_ac": "Q9QUL3", "gene_name": "Pla2g2e", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QUL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUL3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9QUL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUL3" } ] } ] }, { "uniprot_ac": "Q9QXX3", "gene_name": "Pla2g10", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QXX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXX3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9QXX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXX3" } ] } ] }, { "uniprot_ac": "Q9QZT3", "gene_name": "Pla2g10", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QZT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZT3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9QZT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZT3" } ] } ] }, { "uniprot_ac": "Q9QZT4", "gene_name": "Pla2g2f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QZT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZT4" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9QZT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZT4" } ] } ] }, { "uniprot_ac": "Q9QZU4", "gene_name": "Plaat1", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU4" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9QZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9QZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU4" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9QZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU4" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q9QZU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU4" } ] } ] }, { "uniprot_ac": "Q9UL19", "gene_name": "PLAAT4", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9UL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL19" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9UL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL19" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9UL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL19" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9UL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL19" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q9UL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UL19" } ] } ] }, { "uniprot_ac": "Q9UNK4", "gene_name": "PLA2G2D", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9UNK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNK4" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9UNK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNK4" } ] } ] }, { "uniprot_ac": "Q9UP65", "gene_name": "PLA2G4C", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] } ] }, { "uniprot_ac": "Q9VMM8", "gene_name": "Dmel\\CG11029", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] } ] }, { "uniprot_ac": "Q9WVF6", "gene_name": "Pla2g2d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9WVF6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9WVF6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF6" } ] } ] }, { "uniprot_ac": "Q9Z0Y2", "gene_name": "Pla2g1b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9Z0Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0Y2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9Z0Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0Y2" } ] } ] }, { "uniprot_ac": "Q9Z1Q2", "gene_name": "Abhd16a", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q9Z1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Q2" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9Z1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Q2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 105 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }