{ "uniprot_canonical_ac": "P02763-1", "uniprot_ac": "P02763", "uniprot_id": "A1AG1_HUMAN", "mass": { "chemical_mass": 23540.0, "monoisotopic_mass": 23540.0 }, "refseq": { "ac": "NP_000598", "name": "alpha-1-acid glycoprotein 1 precursor", "summary": "This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, "gene_names": [ { "name": "ORM1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02763", "id": "P02763" }, { "name": "A1AG1; AGP-A; AGP1; HEL-S-153w; ORM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598", "id": "NP_000598" }, { "name": "AGP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02763", "id": "P02763" }, { "name": "ORM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598", "id": "NP_000598" } ], "protein_names": [ { "name": "Alpha-1-acid glycoprotein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02763" }, { "name": "AGP 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02763" }, { "name": "OMD 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02763" }, { "name": "Orosomucoid-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02763" }, { "name": "alpha-1-acid glycoprotein 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598", "id": "NP_000598" }, { "name": "alpha-1-acid glycoprotein 1; AGP 1; OMD 1; epididymis secretory sperm binding protein Li 153w", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598", "id": "NP_000598" } ], "function": [ { "annotation": "Evaluation of IFIT3 and ORM1 as Biomarkers for Discriminating Active Tuberculosis from Latent Infection.", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, { "database": "PubMed", "id": "36462134", "url": "https://glygen.org/publication/PubMed/36462134" } ] }, { "annotation": "Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#function" }, { "database": "PubMed", "id": "17321687", "url": "https://glygen.org/publication/PubMed/17321687" }, { "database": "PubMed", "id": "17008009", "url": "https://glygen.org/publication/PubMed/17008009" } ] }, { "annotation": "Integrated GWAS and Gene Expression Suggest ORM1 as a Potential Regulator of Plasma Levels of Cell-Free DNA and Thrombosis Risk.", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, { "database": "PubMed", "id": "35272364", "url": "https://glygen.org/publication/PubMed/35272364" } ] }, { "annotation": "Multiallelic Copy Number Variation in ORM1 is Associated with Plasma Cell-Free DNA Levels as an Intermediate Phenotype for Venous Thromboembolism.", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, { "database": "PubMed", "id": "36696913", "url": "https://glygen.org/publication/PubMed/36696913" } ] }, { "annotation": "ORM 1 as a biomarker of increased vascular invasion and decreased sorafenib sensitivity in hepatocellular carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, { "database": "PubMed", "id": "35765957", "url": "https://glygen.org/publication/PubMed/35765957" } ] }, { "annotation": "Orosomucoid 1 promotes colorectal cancer progression and liver metastasis by affecting PI3K/AKT pathway and inducing macrophage M2 polarization. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" }, { "database": "PubMed", "id": "37640741", "url": "https://glygen.org/publication/PubMed/37640741" } ] }, { "annotation": "This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1159802835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1159802835" }, { "id": "rs1159802835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1159802835" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "9", "chr_pos": "114323231", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1036904612", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1036904612" }, { "id": "rs1036904612", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1036904612#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAA).", "chr_id": "9", "chr_pos": "114323236", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1333212608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333212608" }, { "id": "rs1333212608", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1333212608#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 56, "end_pos": 56, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "9", "chr_pos": "114323716", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775749216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775749216" }, { "id": "rs775749216", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775749216" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 56, "end_pos": 56, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->SKS).", "chr_id": "9", "chr_pos": "114323715", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767328077", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767328077" }, { "id": "rs767328077", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767328077" }, { "id": "rs767328077", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767328077#frequency_tab" }, { "id": "rs767328077", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767328077" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 58, "end_pos": 58, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NK*).", "chr_id": "9", "chr_pos": "114323721", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S58", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767328077", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767328077" }, { "id": "rs767328077", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767328077" }, { "id": "rs767328077", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767328077" }, { "id": "rs767328077", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767328077#frequency_tab" }, { "id": "rs767328077", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767328077" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 58, "end_pos": 58, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NKL).", "chr_id": "9", "chr_pos": "114323721", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S58", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1588922174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588922174" }, { "id": "rs1588922174", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588922174" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 72, "end_pos": 72, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "9", "chr_pos": "114323764", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N72", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746201043", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746201043" }, { "id": "rs746201043", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746201043#frequency_tab" }, { "id": "rs746201043", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746201043" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 72, "end_pos": 72, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "9", "chr_pos": "114323763", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N72", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1439817839", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1439817839" }, { "id": "rs1439817839", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1439817839#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 74, "end_pos": 74, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKA).", "chr_id": "9", "chr_pos": "114323768", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T74", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775455856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775455856" }, { "id": "rs775455856", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775455856" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 93, "end_pos": 93, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->TTT).", "chr_id": "9", "chr_pos": "114324038", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N93", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760105574", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760105574" }, { "id": "rs760105574", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760105574" }, { "id": "rs760105574", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760105574" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 95, "end_pos": 95, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTI).", "chr_id": "9", "chr_pos": "114324044", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T95", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "67.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "54.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "61.93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "63.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "76.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "62.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02763", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02763" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "common_name": "Human" } ], "gene": [ { "name": "ORM1", "url": "https://www.uniprot.org/uniprot/P02763", "locus": { "chromosome": "9", "start_pos": 114326479, "end_pos": 114323098, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000229314", "url": "https://www.ensembl.org/id/ENSG00000229314" } ] } } ], "crossref": [ { "id": "ENSG00000229314", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229314", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19451", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19451", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4285", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4285", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ORM1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ORM1", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "5004", "url": "https://www.ncbi.nlm.nih.gov/gene/5004", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "8498", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8498", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02763", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02763*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001500", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001500", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012674", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012674", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5004", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5004", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "138600", "url": "http://www.omim.org/entry/138600", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02763", "url": "https://www.nextprot.org/entry/NX_P02763", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "KTFMLAF", "url": "https://omabrowser.org/oma/group/KTFMLAF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4563010at2759", "url": "http://www.orthodb.org/?query=4563010at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11967", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11967", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11967:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11967:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3KQ0", "url": "https://www.rcsb.org/structure/3KQ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00061", "url": "http://pfam.xfam.org/family/PF00061", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02763", "url": "https://pharos.nih.gov/targets/P02763", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052842", "url": "https://proconsortium.org/app/entry/PR:000052842", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052843", "url": "https://proconsortium.org/app/entry/PR:000052843", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052844", "url": "https://proconsortium.org/app/entry/PR:000052844", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052845", "url": "https://proconsortium.org/app/entry/PR:000052845", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052846", "url": "https://proconsortium.org/app/entry/PR:000052846", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052847", "url": "https://proconsortium.org/app/entry/PR:000052847", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052848", "url": "https://proconsortium.org/app/entry/PR:000052848", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052849", "url": "https://proconsortium.org/app/entry/PR:000052849", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052850", "url": "https://proconsortium.org/app/entry/PR:000052850", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052851", "url": "https://proconsortium.org/app/entry/PR:000052851", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052852", "url": "https://proconsortium.org/app/entry/PR:000052852", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052853", "url": "https://proconsortium.org/app/entry/PR:000052853", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052854", "url": "https://proconsortium.org/app/entry/PR:000052854", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052855", "url": "https://proconsortium.org/app/entry/PR:000052855", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052856", "url": "https://proconsortium.org/app/entry/PR:000052856", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052857", "url": "https://proconsortium.org/app/entry/PR:000052857", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052858", "url": "https://proconsortium.org/app/entry/PR:000052858", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052859", "url": "https://proconsortium.org/app/entry/PR:000052859", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052860", "url": "https://proconsortium.org/app/entry/PR:000052860", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052861", "url": "https://proconsortium.org/app/entry/PR:000052861", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052862", "url": "https://proconsortium.org/app/entry/PR:000052862", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052863", "url": "https://proconsortium.org/app/entry/PR:000052863", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052864", "url": "https://proconsortium.org/app/entry/PR:000052864", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052865", "url": "https://proconsortium.org/app/entry/PR:000052865", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052866", "url": "https://proconsortium.org/app/entry/PR:000052866", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052867", "url": "https://proconsortium.org/app/entry/PR:000052867", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052868", "url": "https://proconsortium.org/app/entry/PR:000052868", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052869", "url": "https://proconsortium.org/app/entry/PR:000052869", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052870", "url": "https://proconsortium.org/app/entry/PR:000052870", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052871", "url": "https://proconsortium.org/app/entry/PR:000052871", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052872", "url": "https://proconsortium.org/app/entry/PR:000052872", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052873", "url": "https://proconsortium.org/app/entry/PR:000052873", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052874", "url": "https://proconsortium.org/app/entry/PR:000052874", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052875", "url": "https://proconsortium.org/app/entry/PR:000052875", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052876", "url": "https://proconsortium.org/app/entry/PR:000052876", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052877", "url": "https://proconsortium.org/app/entry/PR:000052877", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052878", "url": "https://proconsortium.org/app/entry/PR:000052878", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052879", "url": "https://proconsortium.org/app/entry/PR:000052879", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052880", "url": "https://proconsortium.org/app/entry/PR:000052880", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052881", "url": "https://proconsortium.org/app/entry/PR:000052881", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052882", "url": "https://proconsortium.org/app/entry/PR:000052882", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052883", "url": "https://proconsortium.org/app/entry/PR:000052883", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052884", "url": "https://proconsortium.org/app/entry/PR:000052884", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052885", "url": "https://proconsortium.org/app/entry/PR:000052885", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052886", "url": "https://proconsortium.org/app/entry/PR:000052886", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052887", "url": "https://proconsortium.org/app/entry/PR:000052887", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052888", "url": "https://proconsortium.org/app/entry/PR:000052888", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052889", "url": "https://proconsortium.org/app/entry/PR:000052889", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052890", "url": "https://proconsortium.org/app/entry/PR:000052890", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052891", "url": "https://proconsortium.org/app/entry/PR:000052891", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052892", "url": "https://proconsortium.org/app/entry/PR:000052892", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052893", "url": "https://proconsortium.org/app/entry/PR:000052893", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052894", "url": "https://proconsortium.org/app/entry/PR:000052894", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052895", "url": "https://proconsortium.org/app/entry/PR:000052895", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052896", "url": "https://proconsortium.org/app/entry/PR:000052896", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052897", "url": "https://proconsortium.org/app/entry/PR:000052897", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02763", "url": "http://purl.obolibrary.org/obo/PR_P02763", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02763", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02763-1", "url": "https://www.uniprot.org/uniprot/P02763-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES", "length": 201, "header": "sp|P02763-1|A1AG1_HUMAN Isoform 1 of Alpha-1-acid glycoprotein 1 OS=Homo sapiens OX=9606 GN=ORM1 PE=1 SV=2 CANONICAL=P02763-1" }, "isoforms": [ { "isoform_ac": "P02763-1", "url": "", "sequence": { "sequence": "MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES", "length": 201, "header": "sp|P02763-1|A1AG1_HUMAN Isoform 1 of Alpha-1-acid glycoprotein 1 OS=Homo sapiens OX=9606 GN=ORM1 PE=1 SV=2 CANONICAL=P02763-1" }, "locus": { "chromosome": "9", "start_pos": 114326354, "end_pos": 114323134, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000259396.9", "url": "https://www.ensembl.org/id/ENST00000259396.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000259396.8", "url": "https://www.ensembl.org/id/ENSP00000259396.8" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P02763@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N103" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P02763@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N103" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P02763@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N103" } ] }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P02763@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N103" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "1567356", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1567356" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G27322BI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763@N33", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N33" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N33", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N33" } ] }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "15253437", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1567356" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "4603214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4603214" }, { "id": "1567356", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1567356" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06290IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G50120TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G62165AG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72309KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G73028DK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83213GG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "15253437", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1567356" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G11115RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G28937TW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G31153XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G31665QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G53959KE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71560PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G72309KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "glytoucan_ac": "G73686WG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G81128KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83213GG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "4603214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4603214" }, { "id": "15253437", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1567356" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00776MW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G28916LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G66951WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G71560PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G87108ET", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G91152KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G94239KE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G97968CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "A proteomic analysis of human bile.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" } ] }, { "title": "A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation.", "journal": "Journal of proteome research", "date": "2004", "authors": "Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "15253437", "url": "https://glygen.org/publication/PubMed/15253437" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein.", "journal": "The Biochemical journal", "date": "1992", "authors": "Treuheit MJ, Costello CE, Halsall HB", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "1567356", "url": "https://glygen.org/publication/PubMed/1567356" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Selective binding of imatinib to the genetic variants of human alpha1-acid glycoprotein.", "journal": "Biochim. Biophys. Acta", "date": "2006", "authors": "Fitos I., Mady G., Simonyi M., Visy J., Zsila F.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "17008009", "url": "https://glygen.org/publication/PubMed/17008009" } ] }, { "title": "The drug binding site of human alpha1-acid glycoprotein: insight from induced circular dichroism and electronic absorption spectra.", "journal": "Biochim. Biophys. Acta", "date": "2007", "authors": "Iwao Y., Zsila F.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "17321687", "url": "https://glygen.org/publication/PubMed/17321687" } ] }, { "title": "The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Mueller U., Ravelli R.B., Schonfeld D.L., Skerra A.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "18823996", "url": "https://glygen.org/publication/PubMed/18823996" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" }, { "database": "UniCarbKB", "id": "P02763", "url": "" }, { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" }, { "database": "UniCarbKB", "id": "P02763", "url": "" }, { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other human acute phase protein genes.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Dente L, Ciliberto G, Cortese R", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "2409529", "url": "https://glygen.org/publication/PubMed/2409529" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P02763", "url": "" }, { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02763", "url": "" }, { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "title": "Confident assignment of site-specific glycosylation in complex glycoproteins in a single step.", "journal": "Journal of proteome research", "date": "2014", "authors": "Khatri K, Staples GO, Leymarie N, Leon DR, Turiak L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "25153361", "url": "https://glygen.org/publication/PubMed/25153361" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02763", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Structure and expression of the genes coding for human alpha 1-acid glycoprotein.", "journal": "EMBO J.", "date": "1987", "authors": "Dente L, Pizza MG, Metspalu A, Cortese R", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "2822385", "url": "https://glygen.org/publication/PubMed/2822385" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02763", "url": "" }, { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "A Novel Mass Spectrometry Platform for Multiplexed N-Glycoprotein Biomarker Discovery from Patient Biofluids by Antibody Panel Based N-Glycan Imaging.", "journal": "Analytical chemistry", "date": "2019-07-02", "authors": "Black Alyson P, Liang Hongyan, West Connor A, Wang Mengjun, Herrera Harmin P, Haab Brian B, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31177770", "url": "https://glygen.org/publication/PubMed/31177770" } ] }, { "title": "Antibody Panel Based N-Glycan Imaging for N-Glycoprotein Biomarker Discovery.", "journal": "Current protocols in protein science", "date": "2019-12", "authors": "Black Alyson P, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31721442", "url": "https://glygen.org/publication/PubMed/31721442" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Aberrant sialylation in a patient with a HNF1alpha variant and liver adenomatosis.", "journal": "iScience", "date": "2021", "authors": "Sturiale L, Nassogne MC, Palmigiano A, Messina A, Speciale I, Artuso R, Bertino G, Revencu N, Stephenne X, De Castro C, Matthijs G, Barone R, Jaeken J, Garozzo D", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "33889819", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "718", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Integrated GWAS and Gene Expression Suggest ORM1 as a Potential Regulator of Plasma Levels of Cell-Free DNA and Thrombosis Risk.", "journal": "Thrombosis and haemostasis", "date": "2022", "authors": "Lopez S, Martinez-Perez A, Rodriguez-Rius A, Vinuela A, Brown AA, Martin-Fernandez L, Vilalta N, Arus M, Panousis NI, Buil A, Sabater-Lleal M, Souto JC, Dermitzakis ET, Soria JM", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ], "reference": [ { "type": "PubMed", "id": "35272364", "url": "https://glygen.org/publication/PubMed/35272364" } ] }, { "title": "ORM 1 as a biomarker of increased vascular invasion and decreased sorafenib sensitivity in hepatocellular carcinoma.", "journal": "Bosnian journal of basic medical sciences", "date": "2022-10-23", "authors": "Gu Jiangning, Xu Shiqi, Chen Xiang, Luo Haifeng, Tan Guang, Qi Wenjing, Ling Feng, Wang Chenqi, Maimaiti Feiliyan, Chen Yunlong, Yang Lili, Yin Menghong, Chen Dan", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ], "reference": [ { "type": "PubMed", "id": "35765957", "url": "https://glygen.org/publication/PubMed/35765957" } ] }, { "title": "Evaluation of IFIT3 and ORM1 as Biomarkers for Discriminating Active Tuberculosis from Latent Infection.", "journal": "Current medical science", "date": "2022-12", "authors": "Yang Bing-Fen, Zhai Fei, Yu Shan, An Hong-Juan, Cao Zhi-Hong, Liu Yan-Hua, Wang Ruo, Cheng Xiao-Xing", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ], "reference": [ { "type": "PubMed", "id": "36462134", "url": "https://glygen.org/publication/PubMed/36462134" } ] }, { "title": "Multiallelic Copy Number Variation in ORM1 is Associated with Plasma Cell-Free DNA Levels as an Intermediate Phenotype for Venous Thromboembolism.", "journal": "Thrombosis and haemostasis", "date": "2023-04", "authors": "Martin-Fernandez Laura, Garcia-Mart\u00ednez Iris, Lopez Sonia, Martinez-Perez Angel, Vilalta Noelia, Plaza Melania, Moret Carla, Vi\u00f1uela Ana, Brown Andrew A, Panousis Nikolaos I, Buil Alfonso, Dermitzakis Emmanouil T, Corrales Irene, Souto Juan Carlos, Vidal Francisco, Soria Jose Manuel", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ], "reference": [ { "type": "PubMed", "id": "36696913", "url": "https://glygen.org/publication/PubMed/36696913" } ] }, { "title": "Orosomucoid 1 promotes colorectal cancer progression and liver metastasis by affecting PI3K/AKT pathway and inducing macrophage M2 polarization.", "journal": "Scientific reports", "date": "2023-08-28", "authors": "Yue Lei, Xu Xiaozhang, Dai Shipeng, Xu Fan, Zhao Wenhu, Gu Jian, Dai Xinzheng, Qian Xiaofeng", "evidence": [ { "database": "RefSeq", "id": "NP_000598", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000598" } ], "reference": [ { "type": "PubMed", "id": "37640741", "url": "https://glygen.org/publication/PubMed/37640741" } ] }, { "title": "Molecular cloning and nucleotide sequence of human alpha 1 acid glycoprotein cDNA.", "journal": "Gene", "date": "1986", "authors": "Bentley A.K., Board P.G., Jones I.M.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "3770479", "url": "https://glygen.org/publication/PubMed/3770479" } ] }, { "title": "Isolation and partial characterization of the cyanogen bromide fragments of alpha 1-acid glycoprotein and the elucidation of the amino acid sequence of the carboxyl-terminal cyanogen bromide fragment.", "journal": "Biochemistry", "date": "1972", "authors": "Bauer W., Emura J., Ikenaka T., Isemura S., Ishiguro M., Kaufmann H., Schmid K.", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "4561179", "url": "https://glygen.org/publication/PubMed/4561179" } ] }, { "title": "The disulfide bonds of alpha1-acid glycoprotein.", "journal": "Biochemistry", "date": "1974", "authors": "Schmid K, Burgi W, Collins JH, Nanno S", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763#ptm_processing" }, { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "4603214", "url": "https://glygen.org/publication/PubMed/4603214" } ] }, { "title": "Structure of alpha 1-acid glycoprotein. The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins.", "journal": "Biochemistry", "date": "1973", "authors": "Schmid K, Kaufmann H, Isemura S, Bauer F, Emura J, Motoyama T, Ishiguro M, Nanno S", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "4711474", "url": "https://glygen.org/publication/PubMed/4711474" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Human orosomucoid polymorphism: molecular basis of the three common ORM1 alleles, ORM1*F1, ORM1*F2, and ORM1*S.", "journal": "Hum. Genet.", "date": "1997", "authors": "Yuasa I, Umetsu K, Vogt U, Nakamura H, Nanba E, Tamaki N, Irizawa Y", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "reference": [ { "type": "PubMed", "id": "9050929", "url": "https://glygen.org/publication/PubMed/9050929" } ] } ], "pathway": [ { "id": "hsa:5004", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5004", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P02764-1", "protein_name": "Alpha-1-acid glycoprotein", "gene_name": "Orm1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MALHMVLVVLSLLPLLEAQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP", "length": 205 }, "evidence": [ { "id": "45243123", "url": "http://www.informatics.jax.org/homology/45243123", "database": "MGI" }, { "id": "45243125", "url": "http://www.informatics.jax.org/homology/45243125", "database": "MGI" }, { "id": "45243124", "url": "http://www.informatics.jax.org/homology/45243124", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P07361-1", "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "Orm2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA", "length": 207 }, "evidence": [ { "id": "45243125", "url": "http://www.informatics.jax.org/homology/45243125", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P19652-1", "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES", "length": 201 }, "evidence": [ { "id": "45243123", "url": "http://www.informatics.jax.org/homology/45243123", "database": "MGI" }, { "id": "45243125", "url": "http://www.informatics.jax.org/homology/45243125", "database": "MGI" }, { "id": "45243124", "url": "http://www.informatics.jax.org/homology/45243124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q60590-1", "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "Orm1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA", "length": 207 }, "evidence": [ { "id": "45243124", "url": "http://www.informatics.jax.org/homology/45243124", "database": "MGI" }, { "id": "P02763", "url": "https://omabrowser.org/oma/group/P02763/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q63805-1", "protein_name": "Alpha-1-acid glycoprotein 3", "gene_name": "Orm3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELHTVLIMLSLLPLLEAQNPEHAINIGDPITNETLSWLSGKWFLIAVADSDPDYRQEIQKVQTIFFYLTLNKINDTMELREYHTKDDHCVYNSNLLGFQRENGTLFKYEGEVENPSHLRVLEKHGAIMLFFDLKDEKKRGLSLSARRPDIPPELREVFQKAVTHVGMDESEIIFVDWKKDRCSEQEKKHLELEKETKKDPEESQA", "length": 206 }, "evidence": [ { "id": "45243123", "url": "http://www.informatics.jax.org/homology/45243123", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "specific granule lumen", "id": "GO:0035580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035580", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "tertiary granule lumen", "id": "GO:1904724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904724", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "acute-phase response", "id": "GO:0006953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006953", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "negative regulation of interleukin-6 production", "id": "GO:0032715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032715", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "regulation of immune system process", "id": "GO:0002682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002682", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 production", "id": "GO:0032732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032732", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 1 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052842", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052842" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 2 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052843", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052843" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 3 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G11115RO. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G11115RO. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052844", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052844" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 4 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000052845", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052845" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 5 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052846", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052846" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 6 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G32926LW. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G32926LW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052847", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052847" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 7 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000052848", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052848" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 8 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052849", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052849" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 9 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G41044JW. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G41044JW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052850", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052850" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 10 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G44753VC. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G44753VC. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052851", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052851" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 11 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052852", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052852" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 12 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G60033FS. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G60033FS. [PRO:DNx, PMID:22171320, PMID:29671580]", "evidence": [ { "id": "PR:000052853", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052853" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 13 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052854", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052854" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 14 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052855", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052855" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 15 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052856", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052856" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 16 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G99679NM. Example: UniProtKB:P02763-1, Asn-33, MOD:00160~GNO:G99679NM. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052857", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052857" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 17 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-56 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02763-1, Asn-56, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24841998]", "evidence": [ { "id": "PR:000052858", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052858" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 18 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052859", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052859" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 19 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052860", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052860" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 20 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052861", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052861" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 21 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G11115RO. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G11115RO. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052862", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052862" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 22 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000052863", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052863" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 23 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052864", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052864" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 24 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G31852PQ. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G31852PQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052865", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052865" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 25 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G32926LW. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G32926LW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052866", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052866" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 26 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000052867", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052867" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 27 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G36670VW. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G36670VW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052868", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052868" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 28 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052869", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052869" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 29 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G41044JW. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G41044JW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052870", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052870" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 30 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000052871", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052871" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 31 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G44753VC. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G44753VC. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052872", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052872" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 32 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000052873", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052873" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 33 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052874", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052874" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 34 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan structure is represented by GlyTouCan:G62165AG. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G62165AG. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000052875", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052875" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 35 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052876", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052876" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 36 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052877", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052877" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 37 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G95678HJ. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G95678HJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052878", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052878" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 38 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-72 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G99679NM. Example: UniProtKB:P02763-1, Asn-72, MOD:00160~GNO:G99679NM. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052879", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052879" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 39 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052880", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052880" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 40 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:24841998, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000052881", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052881" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 41 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G11115RO. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G11115RO. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052882", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052882" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 42 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052883", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052883" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 43 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G28937TW. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G28937TW. [PRO:DNx, PMID:24841998]", "evidence": [ { "id": "PR:000052884", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052884" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 44 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G32926LW. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G32926LW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052885", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052885" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 45 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G37818NZ. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G37818NZ. [PRO:DNx, PMID:24841998]", "evidence": [ { "id": "PR:000052886", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052886" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 46 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G39446WN. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G39446WN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052887", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052887" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 47 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052888", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052888" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 48 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G41044JW. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G41044JW. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052889", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052889" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 49 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G44753VC. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G44753VC. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052890", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052890" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 50 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052891", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052891" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 51 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G73686WG. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G73686WG. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052892", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052892" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 52 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052893", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052893" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 53 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052894", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052894" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 54 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052895", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052895" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 55 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G95678HJ. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G95678HJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052896", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052896" } ] }, { "name": "alpha-1-acid glycoprotein 1 N-glycosylated 56 (human)", "definition": "An alpha-1-acid glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-93 of the amino acid sequence represented by UniProtKB:P02763-1, in which the glycan composition is represented by GlyTouCan:G99679NM. Example: UniProtKB:P02763-1, Asn-93, MOD:00160~GNO:G99679NM. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052897", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052897" } ] } ], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 33, "end_pos": 35, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" }, { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated. N-glycan heterogeneity at Asn-33: Hex5HexNAc4 (minor), Hex6HexNAc5 (major) and dHex1Hex6HexNAc5 (minor).", "evidence": [ { "database": "UniProtKB", "id": "P02763", "url": "https://www.uniprot.org/uniprot/P02763" }, { "database": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" }, { "database": "PubMed", "id": "15253437", "url": "https://glygen.org/publication/PubMed/15253437" }, { "database": "PubMed", "id": "1567356", "url": "https://glygen.org/publication/PubMed/1567356" }, { "database": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" }, { "database": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" }, { "database": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Glyco-typer 50 N-glycan liver disease panel", "biomarker_id": "A0245", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" } ], "instances": [ { "best_biomarker_type": "monitoring", "status": "MALDI-MS measured N-glycans", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 195 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 89 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 190 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 89 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }