{ "uniprot_canonical_ac": "P02144-1", "uniprot_ac": "P02144", "uniprot_id": "MYG_HUMAN", "mass": { "chemical_mass": 17184.0, "monoisotopic_mass": 17184.0 }, "refseq": { "ac": "NP_005359", "name": "myoglobin isoform 1", "summary": "This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, "gene_names": [ { "name": "MB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02144", "id": "P02144" }, { "name": "MB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359", "id": "NP_005359" }, { "name": "MYOSB; PVALB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359", "id": "NP_005359" } ], "protein_names": [ { "name": "Myoglobin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02144" }, { "name": "myoglobin isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359", "id": "NP_005359" } ], "function": [ { "annotation": "Comparative analysis of the myoglobin gene in whales and humans reveals evolutionary changes in regulatory elements and expression levels. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, { "database": "PubMed", "id": "37643191", "url": "https://glygen.org/publication/PubMed/37643191" } ] }, { "annotation": "GAPDH is involved in the heme-maturation of myoglobin and hemoglobin.", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, { "database": "PubMed", "id": "34972240", "url": "https://glygen.org/publication/PubMed/34972240" } ] }, { "annotation": "Myoglobin Protects Breast Cancer Cells Due to Its ROS and NO Scavenging Properties. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, { "database": "PubMed", "id": "34671319", "url": "https://glygen.org/publication/PubMed/34671319" } ] }, { "annotation": "Myoglobin in Brown Adipose Tissue: A Multifaceted Player in Thermogenesis. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, { "database": "PubMed", "id": "37759463", "url": "https://glygen.org/publication/PubMed/37759463" } ] }, { "annotation": "Pseudoperoxidase activity, conformational stability, and aggregation propensity of the His98Tyr myoglobin variant: implications for the onset of myoglobinopathy.", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" }, { "database": "PubMed", "id": "34679218", "url": "https://glygen.org/publication/PubMed/34679218" } ] }, { "annotation": "Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.", "evidence": [ { "database": "UniProtKB", "id": "B0QYF7", "url": "https://www.uniprot.org/uniprot/B0QYF7#function" }, { "database": "UniProtKB", "id": "RU251113", "url": "https://www.uniprot.org/uniprot/RU251113#function" }, { "database": "UniProtKB", "id": "ARBA00002755", "url": "https://www.uniprot.org/uniprot/ARBA00002755#function" }, { "database": "UniProtKB", "id": "B0QYF8", "url": "https://www.uniprot.org/uniprot/B0QYF8#function" }, { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144#function" }, { "database": "UniProtKB", "id": "F2Z2F1", "url": "https://www.uniprot.org/uniprot/F2Z2F1#function" }, { "database": "UniProtKB", "id": "F2Z337", "url": "https://www.uniprot.org/uniprot/F2Z337#function" }, { "database": "UniProtKB", "id": "Q8WVH6", "url": "https://www.uniprot.org/uniprot/Q8WVH6#function" } ] }, { "annotation": "This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "80.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "57.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "64.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "59.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "55.47", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "79.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "49.54", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "84.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02144", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02144" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "common_name": "Human" } ], "gene": [ { "name": "MB", "url": "https://www.uniprot.org/uniprot/P02144", "locus": { "chromosome": "22", "start_pos": 35606764, "end_pos": 35637951, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198125", "url": "https://www.ensembl.org/id/ENSG00000198125" } ] } } ], "crossref": [ { "id": "ENSG00000198125", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198125", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08926", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08926", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2406892", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2406892", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MB", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MB", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "4151", "url": "https://www.ncbi.nlm.nih.gov/gene/4151", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6915", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6915", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02144", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02144*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000971", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000971", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002335", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002335", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009050", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009050", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4151", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4151", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "160000", "url": "http://www.omim.org/entry/160000", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02144", "url": "https://www.nextprot.org/entry/NX_P02144", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "MRLFQDH", "url": "https://omabrowser.org/oma/group/MRLFQDH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4233999at2759", "url": "http://www.orthodb.org/?query=4233999at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47132", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47132", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47132:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47132:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3RGK", "url": "https://www.rcsb.org/structure/3RGK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00042", "url": "http://pfam.xfam.org/family/PF00042", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02144", "url": "https://pharos.nih.gov/targets/P02144", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P02144", "url": "http://purl.obolibrary.org/obo/PR_P02144", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B0QYF7", "url": "https://www.uniprot.org/uniprot/B0QYF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYF7-1", "url": "https://www.uniprot.org/uniprot/B0QYF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYF8", "url": "https://www.uniprot.org/uniprot/B0QYF8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYF8-1", "url": "https://www.uniprot.org/uniprot/B0QYF8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2F1", "url": "https://www.uniprot.org/uniprot/F2Z2F1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2F1-1", "url": "https://www.uniprot.org/uniprot/F2Z2F1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z337", "url": "https://www.uniprot.org/uniprot/F2Z337", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z337-1", "url": "https://www.uniprot.org/uniprot/F2Z337-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02144-1", "url": "https://www.uniprot.org/uniprot/P02144-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8WVH6", "url": "https://www.uniprot.org/uniprot/Q8WVH6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8WVH6-1", "url": "https://www.uniprot.org/uniprot/Q8WVH6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG", "length": 154, "header": "sp|P02144-1|MYG_HUMAN Isoform 1 of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=2 CANONICAL=P02144-1" }, "isoforms": [ { "isoform_ac": "B0QYF7-1", "url": "", "sequence": { "sequence": "MKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQ", "length": 74, "header": "tr|B0QYF7-1|MYG_HUMAN Computationally mapped isoform of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=1 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35611036, "end_pos": 35607375, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000442617.1", "url": "https://www.ensembl.org/id/ENST00000442617.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000413309.1", "url": "https://www.ensembl.org/id/ENSP00000413309.1" } ] } }, { "isoform_ac": "B0QYF8-1", "url": "", "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDM", "length": 143, "header": "tr|B0QYF8-1|MYG_HUMAN Computationally mapped isoform of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=1 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35617257, "end_pos": 35607333, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443033.5", "url": "https://www.ensembl.org/id/ENST00000443033.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000403351.1", "url": "https://www.ensembl.org/id/ENSP00000403351.1" } ] } }, { "isoform_ac": "F2Z2F1-1", "url": "", "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLE", "length": 106, "header": "tr|F2Z2F1-1|MYG_HUMAN Computationally mapped isoform of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=1 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35617257, "end_pos": 35610884, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000451685.5", "url": "https://www.ensembl.org/id/ENST00000451685.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000397944.1", "url": "https://www.ensembl.org/id/ENSP00000397944.1" } ] } }, { "isoform_ac": "F2Z337-1", "url": "", "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGIL", "length": 77, "header": "tr|F2Z337-1|MYG_HUMAN Computationally mapped isoform of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=1 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35617257, "end_pos": 35610971, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000419229.1", "url": "https://www.ensembl.org/id/ENST00000419229.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000414243.1", "url": "https://www.ensembl.org/id/ENSP00000414243.1" } ] } }, { "isoform_ac": "P02144-1", "url": "", "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG", "length": 154, "header": "sp|P02144-1|MYG_HUMAN Isoform 1 of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=2 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35617257, "end_pos": 35607300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000397328.5", "url": "https://www.ensembl.org/id/ENST00000397328.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000380491.1", "url": "https://www.ensembl.org/id/ENSP00000380491.1" } ] } }, { "isoform_ac": "Q8WVH6-1", "url": "", "sequence": { "sequence": "MKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG", "length": 99, "header": "tr|Q8WVH6-1|MYG_HUMAN Computationally mapped isoform of Myoglobin OS=Homo sapiens OX=9606 GN=MB PE=1 SV=1 CANONICAL=P02144-1" }, "locus": { "chromosome": "22", "start_pos": 35611036, "end_pos": 35607300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000401702.5", "url": "https://www.ensembl.org/id/ENST00000401702.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000386060.1", "url": "https://www.ensembl.org/id/ENSP00000386060.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "site_lbl": "Ser4" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "site_lbl": "Thr68" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Assignment of the heme axial ligand(s) for the ferric myoglobin (H93G) and heme oxygenase (H25A) cavity mutants as oxygen donors using magnetic circular dichroism.", "journal": "Biochemistry", "date": "1999", "authors": "Pond AE, Roach MP, Sono M, Rux AH, Franzen S, Hu R, Thomas MR, Wilks A, Dou Y, Ikeda-Saito M, Ortiz de Montellano PR, Woodruff WH, Boxer SG, Dawson JH", "evidence": [ { "database": "Entrez", "id": "4151", "url": "https://www.ncbi.nlm.nih.gov/gene/4151" } ], "reference": [ { "type": "PubMed", "id": "10360958", "url": "https://glygen.org/publication/PubMed/10360958" } ] }, { "title": "A vertebrate globin expressed in the brain.", "journal": "Nature", "date": "2000", "authors": "Burmester T, Weich B, Reinhardt S, Hankeln T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "11029004", "url": "https://glygen.org/publication/PubMed/11029004" } ] }, { "title": "Human neuroglobin, a hexacoordinate hemoglobin that reversibly binds oxygen.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Trent JT 3rd, Watts RA, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "11429401", "url": "https://glygen.org/publication/PubMed/11429401" } ] }, { "title": "The myoglobin of primates. I. Hylobates agilis (gibbon).", "journal": "Biochim. Biophys. Acta", "date": "1971", "authors": "Lehmann H., Romero-Herrera A.E.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "11452891", "url": "https://glygen.org/publication/PubMed/11452891" } ] }, { "title": "Biochemical characterization and ligand binding properties of neuroglobin, a novel member of the globin family.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Dewilde S, Kiger L, Burmester T, Hankeln T, Baudin-Creuza V, Aerts T, Marden MC, Caubergs R, Moens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "11473128", "url": "https://glygen.org/publication/PubMed/11473128" } ] }, { "title": "A ubiquitously expressed human hexacoordinate hemoglobin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Trent JT 3rd, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "11893755", "url": "https://glygen.org/publication/PubMed/11893755" } ] }, { "title": "Cytoglobin: a novel globin type ubiquitously expressed in vertebrate tissues.", "journal": "Molecular biology and evolution", "date": "2002", "authors": "Burmester T, Ebner B, Weich B, Hankeln T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "11919282", "url": "https://glygen.org/publication/PubMed/11919282" } ] }, { "title": "Human brain neuroglobin structure reveals a distinct mode of controlling oxygen affinity.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Pesce A, Dewilde S, Nardini M, Moens L, Ascenzi P, Hankeln T, Burmester T, Bolognesi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "12962627", "url": "https://glygen.org/publication/PubMed/12962627" } ] }, { "title": "Studies on the oxygen and carbon monoxide equilibria of human myoglobin.", "journal": "Archives of biochemistry and biophysics", "date": "1958", "authors": "ROSSI-FANELLI A, ANTONINI E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "13584010", "url": "https://glygen.org/publication/PubMed/13584010" } ] }, { "title": "The redox state of the cell regulates the ligand binding affinity of human neuroglobin and cytoglobin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hamdane D, Kiger L, Dewilde S, Green BN, Pesce A, Uzan J, Burmester T, Hankeln T, Bolognesi M, Moens L, Marden MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "14530264", "url": "https://glygen.org/publication/PubMed/14530264" } ] }, { "title": "Allosteric regulation and temperature dependence of oxygen binding in human neuroglobin and cytoglobin. Molecular mechanisms and physiological significance.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fago A, Hundahl C, Dewilde S, Gilany K, Moens L, Weber RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "15299006", "url": "https://glygen.org/publication/PubMed/15299006" } ] }, { "title": "Human myoglobin recognition of oxygen: dynamics of the energy landscape.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Wang Y, Baskin JS, Xia T, Zewail AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "15601759", "url": "https://glygen.org/publication/PubMed/15601759" } ] }, { "title": "Topology and thermodynamics of gaseous ligands diffusion paths in human neuroglobin.", "journal": "Bio Systems", "date": "2008", "authors": "Orlowski S, Nowak W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "18718500", "url": "https://glygen.org/publication/PubMed/18718500" } ] }, { "title": "Relating the diffusion of small ligands in human neuroglobin to its structural and mechanical properties.", "journal": "The journal of physical chemistry. B", "date": "2009", "authors": "Bocahut A, Bernad S, Sebban P, Sacquin-Mora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "19919085", "url": "https://glygen.org/publication/PubMed/19919085" } ] }, { "title": "'It's hollow': the function of pores within myoglobin.", "journal": "The Journal of experimental biology", "date": "2010", "authors": "Tomita A, Kreutzer U, Adachi S, Koshihara SY, Jue T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "20675544", "url": "https://glygen.org/publication/PubMed/20675544" } ] }, { "title": "Human neuroglobin functions as an oxidative stress-responsive sensor for neuroprotection.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Watanabe S, Takahashi N, Uchida H, Wakasugi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "22787149", "url": "https://glygen.org/publication/PubMed/22787149" } ] }, { "title": "Neuroglobin and cytoglobin expression in the human brain.", "journal": "Brain structure & function", "date": "2013", "authors": "Hundahl CA, Kelsen J, Hay-Schmidt A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "23160832", "url": "https://glygen.org/publication/PubMed/23160832" } ] }, { "title": "Interaction between myoglobin and mitochondria in rat skeletal muscle.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2013", "authors": "Yamada T, Furuichi Y, Takakura H, Hashimoto T, Hanai Y, Jue T, Masuda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "23195625", "url": "https://glygen.org/publication/PubMed/23195625" } ] }, { "title": "X-ray crystal structure of a recombinant human myoglobin mutant at 2.8-A resolution.", "journal": "J. Mol. Biol.", "date": "1990", "authors": "Hubbard SR, Hendrickson WA, Lambright DG, Boxer SG", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "2342104", "url": "https://glygen.org/publication/PubMed/2342104" } ] }, { "title": "Cloning of the human myoglobin gene.", "journal": "Gene", "date": "1985", "authors": "Akaboshi E", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "2989088", "url": "https://glygen.org/publication/PubMed/2989088" } ] }, { "title": "The impact of 2019 novel coronavirus on heart injury: A Systematic review and Meta-analysis.", "journal": "Progress in cardiovascular diseases", "date": "2020", "authors": "Li JW, Han TW, Woodward M, Anderson CS, Zhou H, Chen YD, Neal B", "evidence": [ { "database": "GlyGen", "id": "A0103", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32305557", "url": "https://glygen.org/publication/PubMed/32305557" } ] }, { "title": "Elevated cardiac biomarkers are associated with increased mortality for inpatients with COVID-19: A retrospective case-control study.", "journal": "Journal of clinical anesthesia", "date": "2020", "authors": "Su M, Wang Y, Peng J, Wu MJ, Deng W, Yang YS", "evidence": [ { "database": "GlyGen", "id": "A0103", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32450473", "url": "https://glygen.org/publication/PubMed/32450473" } ] }, { "title": "Myoglobin Protects Breast Cancer Cells Due to Its ROS and NO Scavenging Properties.", "journal": "Frontiers in endocrinology", "date": "2021", "authors": "Quinting T, Heymann AK, Bicker A, Nauth T, Bernardini A, Hankeln T, Fandrey J, Schreiber T", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ], "reference": [ { "type": "PubMed", "id": "34671319", "url": "https://glygen.org/publication/PubMed/34671319" } ] }, { "title": "Pseudoperoxidase activity, conformational stability, and aggregation propensity of the His98Tyr myoglobin variant: implications for the onset of myoglobinopathy.", "journal": "The FEBS journal", "date": "2022", "authors": "Hofbauer S, Pignataro M, Borsari M, Bortolotti CA, Di Rocco G, Ravenscroft G, Furtmuller PG, Obinger C, Sola M, Battistuzzi G", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ], "reference": [ { "type": "PubMed", "id": "34679218", "url": "https://glygen.org/publication/PubMed/34679218" } ] }, { "title": "GAPDH is involved in the heme-maturation of myoglobin and hemoglobin.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2022", "authors": "Tupta B, Stuehr E, Sumi MP, Sweeny EA, Smith B, Stuehr DJ, Ghosh A", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ], "reference": [ { "type": "PubMed", "id": "34972240", "url": "https://glygen.org/publication/PubMed/34972240" } ] }, { "title": "Comparative analysis of the myoglobin gene in whales and humans reveals evolutionary changes in regulatory elements and expression levels.", "journal": "PloS one", "date": "2023", "authors": "Sackerson Charles, Garcia Vivian, Medina Nicole, Maldonado Jessica, Daly John, Cartwright Rachel", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ], "reference": [ { "type": "PubMed", "id": "37643191", "url": "https://glygen.org/publication/PubMed/37643191" } ] }, { "title": "Myoglobin in Brown Adipose Tissue: A Multifaceted Player in Thermogenesis.", "journal": "Cells", "date": "2023-09-08", "authors": "Aboouf Mostafa A, Gorr Thomas A, Hamdy Nadia M, Gassmann Max, Thiersch Markus", "evidence": [ { "database": "RefSeq", "id": "NP_005359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005359" } ], "reference": [ { "type": "PubMed", "id": "37759463", "url": "https://glygen.org/publication/PubMed/37759463" } ] }, { "title": "The myoglobin of primates. II. Pan troglodytes (chimpanzee).", "journal": "Biochim. Biophys. Acta", "date": "1972", "authors": "Romero Herrera AE, Lehmann H", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "4627044", "url": "https://glygen.org/publication/PubMed/4627044" } ] }, { "title": "Variants of human myoglobin: their oxygen dissociation curves.", "journal": "British journal of haematology", "date": "1972", "authors": "Boulton FE, Huntsman RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8981607", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607" } ], "reference": [ { "type": "PubMed", "id": "5032105", "url": "https://glygen.org/publication/PubMed/5032105" } ] }, { "title": "Primary structure of human myoglobin.", "journal": "Nature New Biol.", "date": "1971", "authors": "Herrera AE, Lehmann H", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "5285572", "url": "https://glygen.org/publication/PubMed/5285572" } ] }, { "title": "The second variant of human myoglobin; 138(H16) arginine leads to glutamine.", "journal": "Br. J. Haematol.", "date": "1971", "authors": "Lorkin P.A., Huntsman R.G., Boulton F.E., Romero-Herrera A.E., Yawson G.I.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "5540041", "url": "https://glygen.org/publication/PubMed/5540041" } ] }, { "title": "The third variant of human myoglobin showing an unusual amino acid substitution: 138(H16)arginine-->tryptophan.", "journal": "Biochim. Biophys. Acta", "date": "1971", "authors": "Lehmann H., Lorkin P.A., Huntsman R.G., Boulton F.E., Romero Herrera A.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "5555219", "url": "https://glygen.org/publication/PubMed/5555219" } ] }, { "title": "A human myoglobin variant 133 (H-10)lysine-->asparagine.", "journal": "Biochim. Biophys. Acta", "date": "1971", "authors": "Lehmann H., Lorkin P.A., Huntsman R.G., Boulton F.E., Romero Herrera A.E.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "5555226", "url": "https://glygen.org/publication/PubMed/5555226" } ] }, { "title": "Abnormal human myoglobin: 53 (D4) glutamic acid-->lysine.", "journal": "Nature", "date": "1969", "authors": "Lehmann H., Lorkin P.A., Huntsman R.G., Boulton F.E.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "5805522", "url": "https://glygen.org/publication/PubMed/5805522" } ] }, { "title": "Organization of the human myoglobin gene.", "journal": "EMBO J.", "date": "1984", "authors": "Wilson V., Jeffreys A.J., Weller P., Blanchetot A.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "6571704", "url": "https://glygen.org/publication/PubMed/6571704" } ] }, { "title": "The human myocardial two-dimensional gel protein database: update 1994.", "journal": "Electrophoresis", "date": "1994", "authors": "Baker C.S., Corbett J.M., Dunn M.J., Wheeler C.H., Yacoub M.H.", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "reference": [ { "type": "PubMed", "id": "7895732", "url": "https://glygen.org/publication/PubMed/7895732" } ] } ], "pathway": [ { "id": "hsa:4151", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4151", "resource": "KEGG Pathway" }, { "id": "R-HSA-8981607", "name": "Intracellular oxygen transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8981607", "resource": "Reactome", "description": "Intracellular oxygen transport" } ], "orthologs": [ { "uniprot_canonical_ac": "P04247-1", "protein_name": "Myoglobin", "gene_name": "Mb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG", "length": 154 }, "evidence": [ { "id": "45227520", "url": "http://www.informatics.jax.org/homology/45227520", "database": "MGI" }, { "id": "P02144", "url": "https://omabrowser.org/oma/group/P02144/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QZ76-1", "protein_name": "Myoglobin", "gene_name": "Mb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG", "length": 154 }, "evidence": [ { "id": "45227520", "url": "http://www.informatics.jax.org/homology/45227520", "database": "MGI" }, { "id": "P02144", "url": "https://omabrowser.org/oma/group/P02144/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "oxygen binding", "id": "GO:0019825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019825", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "oxygen carrier activity", "id": "GO:0005344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005344", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "enucleate erythrocyte differentiation", "id": "GO:0043353", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043353", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "brown fat cell differentiation", "id": "GO:0050873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050873", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "oxygen transport", "id": "GO:0015671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015671", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "hydrogen peroxide mediated signaling pathway", "id": "GO:0071588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071588", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02144", "url": "https://www.uniprot.org/uniprot/P02144" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Myoglobin (MB)", "biomarker_id": "A0103", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32450473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32450473" }, { "id": "32305557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32305557" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased MB level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32450473", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32450473" }, { "id": "32305557", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32305557" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }