{
    "uniprot_canonical_ac": "P01631-1",
    "uniprot_ac": "P01631",
    "uniprot_id": "KV2A7_MOUSE",
    "mass": {
        "chemical_mass": 12273.0,
        "monoisotopic_mass": 12273.0
    },
    "refseq": {},
    "gene_names": [],
    "protein_names": [
        {
            "name": "Ig kappa chain V-II region 26-10",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P01631"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P01631",
                    "url": "https://www.uniprot.org/uniprot/P01631"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/P01631",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "cd04980",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04980",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P01631",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P01631*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR003599",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007110",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013106",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013783",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036179",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P01631",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01631",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "PTHR23267",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR23267:SF278",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267:SF278",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1BFV",
            "url": "https://www.rcsb.org/structure/1BFV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1CFV",
            "url": "https://www.rcsb.org/structure/1CFV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1DLF",
            "url": "https://www.rcsb.org/structure/1DLF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1MAJ",
            "url": "https://www.rcsb.org/structure/1MAJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1MAK",
            "url": "https://www.rcsb.org/structure/1MAK",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1N4X",
            "url": "https://www.rcsb.org/structure/1N4X",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1SVZ",
            "url": "https://www.rcsb.org/structure/1SVZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1WZ1",
            "url": "https://www.rcsb.org/structure/1WZ1",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2BFV",
            "url": "https://www.rcsb.org/structure/2BFV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2DLF",
            "url": "https://www.rcsb.org/structure/2DLF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2HKF",
            "url": "https://www.rcsb.org/structure/2HKF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2HKH",
            "url": "https://www.rcsb.org/structure/2HKH",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2IPT",
            "url": "https://www.rcsb.org/structure/2IPT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2IQA",
            "url": "https://www.rcsb.org/structure/2IQA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2O5X",
            "url": "https://www.rcsb.org/structure/2O5X",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2O5Y",
            "url": "https://www.rcsb.org/structure/2O5Y",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2O5Z",
            "url": "https://www.rcsb.org/structure/2O5Z",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2R0W",
            "url": "https://www.rcsb.org/structure/2R0W",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2VQ1",
            "url": "https://www.rcsb.org/structure/2VQ1",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF07686",
            "url": "http://pfam.xfam.org/family/PF07686",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P01631",
            "url": "https://www.uniprot.org/uniprot/P01631",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P01631-1",
            "url": "https://www.uniprot.org/uniprot/P01631-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR",
        "length": 113,
        "header": "sp|P01631-1|KV2A7_MOUSE Isoform 1 of Ig kappa chain V-II region 26-10  OS=Mus musculus OX=10090 GN= PE=1 SV=1 CANONICAL=P01631-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P01631-1",
            "url": "",
            "sequence": {
                "sequence": "DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR",
                "length": 113,
                "header": "sp|P01631-1|KV2A7_MOUSE Isoform 1 of Ig kappa chain V-II region 26-10  OS=Mus musculus OX=10090 GN= PE=1 SV=1 CANONICAL=P01631-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "P01631",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01631"
                },
                {
                    "id": "36288343",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/36288343"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.",
            "journal": "PloS one",
            "date": "2022",
            "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "P01631",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01631"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36288343",
                    "url": "https://glygen.org/publication/PubMed/36288343"
                }
            ]
        },
        {
            "title": "Amino acid sequence of the light chain variable region from a mouse anti-digoxin hybridoma antibody.",
            "journal": "Biochemistry",
            "date": "1983",
            "authors": "Margolies M.N., Novotny J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P01631",
                    "url": "https://www.uniprot.org/uniprot/P01631"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6404298",
                    "url": "https://glygen.org/publication/PubMed/6404298"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "extracellular space",
                        "id": "GO:0005615",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P01631",
                                "url": "https://www.uniprot.org/uniprot/P01631"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "immunoglobulin complex",
                        "id": "GO:0019814",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P01631",
                                "url": "https://www.uniprot.org/uniprot/P01631"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "immune response",
                        "id": "GO:0006955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P01631",
                                "url": "https://www.uniprot.org/uniprot/P01631"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "adaptive immune response",
                        "id": "GO:0002250",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P01631",
                                "url": "https://www.uniprot.org/uniprot/P01631"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "antigen binding",
                        "id": "GO:0003823",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P01631",
                                "url": "https://www.uniprot.org/uniprot/P01631"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}