{ "uniprot_canonical_ac": "P01572-1", "uniprot_ac": "P01572", "uniprot_id": "IFNA1_MOUSE", "mass": { "chemical_mass": 21646.0, "monoisotopic_mass": 21646.0 }, "refseq": { "ac": "NP_034632", "name": "interferon alpha-1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, "gene_names": [ { "name": "Ifna1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01572", "id": "P01572" }, { "name": "If1ai14; Ifa1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632", "id": "NP_034632" }, { "name": "Ifna1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632", "id": "NP_034632" } ], "protein_names": [ { "name": "Interferon alpha-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01572" }, { "name": "IFN-alpha-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01572" }, { "name": "interferon alpha family gene 1; IFN-alpha-1; interferon 1ai14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632", "id": "NP_034632" }, { "name": "interferon alpha-1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632", "id": "NP_034632" } ], "function": [ { "annotation": "Frontline Science: Estrogen-related receptor gamma increases poly(I:C)-mediated type I IFN expression in mouse macrophages.", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, { "database": "PubMed", "id": "33615540", "url": "https://glygen.org/publication/PubMed/33615540" } ] }, { "annotation": "Mechanism of SUMOylation-Mediated Regulation of Type I IFN Expression.", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, { "database": "PubMed", "id": "36681180", "url": "https://glygen.org/publication/PubMed/36681180" } ] }, { "annotation": "Obesity worsens survival of influenza infected mice with impaired type I interferon. In particular, IFN-alpha and IFN-beta levels were significantly suppressed in the bronchoalveolar lavage fluid of diet-induced obese mice.", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, { "database": "PubMed", "id": "30967261", "url": "https://glygen.org/publication/PubMed/30967261" } ] }, { "annotation": "Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572#function" }, { "database": "PubMed", "id": "15254193", "url": "https://glygen.org/publication/PubMed/15254193" } ] }, { "annotation": "The role of type 1 interferons in coagulation induced by gram-negative bacteria.", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, { "database": "PubMed", "id": "32016282", "url": "https://glygen.org/publication/PubMed/32016282" } ] }, { "annotation": "These findings also identify STAT3 as a therapeutic target against viral infection and highlight it as an essential pathway component for endogenous and therapeutic IFN-alpha responsiveness.", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" }, { "database": "PubMed", "id": "27988795", "url": "https://glygen.org/publication/PubMed/27988795" } ] } ], "disease": [ { "disease_id": "DOID:0080208", "recommended_name": { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated steatotic liver disease", "description": "A steatotic liver disease characterized by at least one of five cardiometabolic risk factors (adjusted for age, sex and ethnicity), alcohol consumption below 140g/week (female) or 210g/week (male), and no other discernible cause. The five cardiometabolic risk factors are:(1) Body mass index 25 kg/m2 (adult), 23 kg/m2 (adult Asian), or 85th percentile (pediatric); waist circumference > 94 cm (adult male), 80 cm (adult female), or 95th percentile (pediatric); or ethnicity adjusted equivalents.(2) Fasting serum glucose 5.6 mmol/L, 2-hr post-load glucose levels 7.8 mmol/L, glycated hemoglobin (HbA1c) 5.7% (39 mmol/L), type 2 diabetes, treatment for type 2 diabetes, previously diagnosed or treated type 2 diabetes (pediatric only), or serum glucose 11.1 mmol/L (pediatric only).(3) Blood pressure lower of 130/85 mmHg or 95th percentile (age < 13 years), or 130/85 mmHg (age 13 years); or specific hypertensive drug treatment.(4) Plasma triglycerides 1.15 mmol/L (age < 10 years) or 1.70 mmol/L (age 10 years); or lipid lowering treatment.(5) Plasma high-density lipoprotein cholesterol 1.0 mmol/L (adult male, pediatric) or 1.3 mmol/L (adult female); or lipid lowering treatment." }, "synonyms": [ { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "non-alcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "NAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-related steatotic liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MASLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "nonalcoholic fatty liver disease", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "NAFLD2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "fatty liver disease, nonalcoholic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "liver disease, alcoholic, susceptibility to, 1", "description": "" }, { "id": "MIM:613282", "resource": "MIM", "url": "https://www.omim.org/entry/613282", "name": "Non-alcoholic fatty liver disease 1", "description": "Non-alcoholic fatty liver disease 1" } ], "evidence": [ { "id": "0080208", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080208" } ] }, { "disease_id": "DOID:10459", "recommended_name": { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "common cold", "description": "An upper respiratory tract disease which involves inflammation of the mucous membranes of the nose, throat, eyes, and eustachian tubes with watery then purulent discharge. This is an acute contagious disease caused by rhinoviruses, human parainfluenza viruses, human respiratory syncytial virus, influenza viruses, adenoviruses, enteroviruses, or metapneumovirus." }, "synonyms": [ { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "Acute viral rhinopharyngitis", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "Nasopharyngitis - acute", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "Nasopharyngitis, acute", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "acute coryza", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "acute nasopharyngitis", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "acute rhinitis", "description": "" }, { "id": "DOID:10459", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10459", "name": "rhino-sinusitis", "description": "" } ], "evidence": [ { "id": "10459", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10459" } ] }, { "disease_id": "DOID:11168", "recommended_name": { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "anogenital venereal wart", "description": "A viral infectious disease that results_in infection located_in skin of vagina, cervix, uterus, anus, penis, scrotum, mouth, or throat, has_material_basis_in human papillomaviruses (types 6 and 11), which are transmitted_by direct contact with the skin during oral, genital, or anal sex with an infected partner. The infection has_symptom anogenital warts." }, "synonyms": [ { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Anogenital warts", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Genital warts", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "Anogenital Human papilloma Virus Infectious Disease", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "genital wart virus infectious disease", "description": "" }, { "id": "DOID:11168", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11168", "name": "venereal wart", "description": "" } ], "evidence": [ { "id": "11168", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11168" } ] }, { "disease_id": "DOID:11335", "recommended_name": { "id": "DOID:11335", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11335", "name": "sarcoidosis", "description": "A hypersensitivity reaction type IV disease characterized by the growth of collections of inflammatory cells (granulomas) in multiple organs." }, "synonyms": [ { "id": "DOID:11335", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11335", "name": "Boeck sarcoid", "description": "" }, { "id": "DOID:11335", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11335", "name": "lymphogranulomatosis", "description": "" } ], "evidence": [ { "id": "11335", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11335" } ] }, { "disease_id": "DOID:12287", "recommended_name": { "id": "DOID:12287", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12287", "name": "Crimean-Congo hemorrhagic fever", "description": "A viral infectious disease that is a hemorrhagic fever, has_material_basis_in Orthonairovirus haemorrhagiae, which is transmitted_by Hyalomma ticks. The infection has_symptom headache, has_symptom high fever, has_symptom back pain, has_symptom joint pain, has_symptom stomach pain, has_symptom vomiting, has_symptom red eyes, has_symptom flushed face, has_symptom red throat, has_symptom petechiae (red spots) on the palate, has_symptom jaundice, has_symptom nosebleeds, and has_symptom blood in the feces and urine." }, "synonyms": [ { "id": "DOID:12287", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12287", "name": "CHF Congo virus", "description": "" }, { "id": "DOID:12287", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12287", "name": "Congo-Crimean Hemorrhagic Fever", "description": "" }, { "id": "DOID:12287", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12287", "name": "Crimean hemorrhagic fever", "description": "" } ], "evidence": [ { "id": "12287", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12287" } ] }, { "disease_id": "DOID:1883", "recommended_name": { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "hepatitis C", "description": "A viral infectious disease that results_in inflammation located_in liver, has_material_basis_in Hepacivirus hominis, which is transmitted_by blood from an infected person enters the body of an uninfected person. The infection has_symptom fever, has_symptom fatigue, has_symptom loss of appetite, has_symptom nausea, has_symptom vomiting, has_symptom abdominal pain, has_symptom clay-colored bowel movements, has_symptom joint pain, and has_symptom jaundice." }, "synonyms": [ { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "NANBH", "description": "" }, { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "Viral hepatitis C", "description": "" }, { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "chronic hepatitis C", "description": "" }, { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "hepatitis C infection", "description": "" }, { "id": "DOID:1883", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1883", "name": "hepatitis nonA nonB", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "hepatitis C virus infection", "description": "A viral infection caused by the hepatitis C virus." }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "Hepatitis C virus caused hepatitis", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "Hepatitis C virus hepatitis", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "NANBH", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "hepatitis C infection", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "hepatitis Nona nonB", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "hepatitis type C", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "non-A, non-B Hepatitis", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "viral hepatitis C", "description": "" }, { "id": "MONDO:0005231", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005231", "name": "chronic hepatitis C", "description": "" } ], "evidence": [ { "id": "1883", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1883" } ] }, { "disease_id": "DOID:2043", "recommended_name": { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "hepatitis B", "description": "A viral infectious disease that results_in inflammation located_in liver, has_material_basis_in Hepatitis B virus, which is transmitted_by sexual contact, blood transfusions, or fomites like needles or syringes. The infection has_symptom fever, fatigue, loss of appetite, nausea, vomiting, abdominal pain, clay-colored bowel movements, joint pain, and jaundice." }, "synonyms": [ { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "chronic hepatitis B", "description": "" }, { "id": "DOID:2043", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2043", "name": "hepatitis B infection", "description": "" } ], "evidence": [ { "id": "2043", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2043" } ] }, { "disease_id": "DOID:5052", "recommended_name": { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "melioidosis", "description": "A primary bacterial infectious disease that results_in infection, has_material_basis_in Burkholderia pseudomallei, which is transmitted_by contact with the contaminated water or soil. The infection has_symptom fever, has_symptom respiratory distress, has_symptom chest pain, and has_symptom stomach pain." }, "synonyms": [ { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "Nightcliff gardener's disease", "description": "" }, { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "Pseudoglanders", "description": "" }, { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "Whitmore's disease", "description": "" }, { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "acute and fulminating melioidosis", "description": "" }, { "id": "DOID:5052", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5052", "name": "subacute and chronic melioidosis", "description": "" } ], "evidence": [ { "id": "5052", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5052" } ] }, { "disease_id": "DOID:5082", "recommended_name": { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "liver cirrhosis", "description": "" }, "synonyms": [ { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "Cirrhosis", "description": "" }, { "id": "DOID:5082", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5082", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "A disorder characterized by replacement of the liver parenchyma with fibrous tissue and regenerative nodules. It is usually caused by alcoholism, hepatitis B, and hepatitis C. Complications include the development of ascites, esophageal varices, bleeding, and hepatic encephalopathy." }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "cirrhosis of liver", "description": "" }, { "id": "MONDO:0005155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005155", "name": "liver cirrhosis", "description": "" } ], "evidence": [ { "id": "5082", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5082" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ifna1", "url": "https://www.uniprot.org/uniprot/P01572", "locus": { "chromosome": "4", "start_pos": 88768893, "end_pos": 88768324, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000095498", "url": "https://www.ensembl.org/id/ENSMUSG00000095498" } ] } } ], "crossref": [ { "id": "cd00095", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00095", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "15962", "url": "https://www.ncbi.nlm.nih.gov/gene/15962", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15962", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15962", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107668", "url": "http://www.informatics.jax.org/marker/MGI:107668", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WHEDSRN", "url": "https://omabrowser.org/oma/group/WHEDSRN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5358931at2759", "url": "http://www.orthodb.org/?query=5358931at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11691", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11691", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11691:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11691:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00143", "url": "http://pfam.xfam.org/family/PF00143", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P01572", "url": "http://purl.obolibrary.org/obo/PR_P01572", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-909733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-912694", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-912694", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01572-1", "url": "https://www.uniprot.org/uniprot/P01572-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK", "length": 189, "header": "sp|P01572-1|IFNA1_MOUSE Isoform 1 of Interferon alpha-1 OS=Mus musculus OX=10090 GN=Ifna1 PE=1 SV=2 CANONICAL=P01572-1" }, "isoforms": [ { "isoform_ac": "P01572-1", "url": "", "sequence": { "sequence": "MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK", "length": 189, "header": "sp|P01572-1|IFNA1_MOUSE Isoform 1 of Interferon alpha-1 OS=Mus musculus OX=10090 GN=Ifna1 PE=1 SV=2 CANONICAL=P01572-1" }, "locus": { "chromosome": "4", "start_pos": 88768890, "end_pos": 88768324, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000094972", "url": "https://www.ensembl.org/id/ENSMUST00000094972" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000092580", "url": "https://www.ensembl.org/id/ENSMUSP00000092580" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P01572", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01572#ptm_processing" }, { "id": "15254193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15254193" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Characterization of the murine alpha interferon gene family.", "journal": "Journal of virology", "date": "2004", "authors": "van Pesch V, Lanaya H, Renauld JC, Michiels T", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572#ptm_processing" }, { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "reference": [ { "type": "PubMed", "id": "15254193", "url": "https://glygen.org/publication/PubMed/15254193" } ] }, { "title": "A novel anti-viral role for STAT3 in IFN-alpha signalling responses.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2017", "authors": "Mahony R, Gargan S, Roberts KL, Bourke N, Keating SE, Bowie AG, O'Farrelly C, Stevenson NJ", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" } ], "reference": [ { "type": "PubMed", "id": "27988795", "url": "https://glygen.org/publication/PubMed/27988795" } ] }, { "title": "Characterization of a mouse interferon gene locus I. Isolation of a cluster of four alpha interferon genes.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Pitha P.M., Kelly K.A.", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "reference": [ { "type": "PubMed", "id": "2987811", "url": "https://glygen.org/publication/PubMed/2987811" } ] }, { "title": "Obesity worsens the outcome of influenza virus infection associated with impaired type I interferon induction in mice.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Namkoong H, Ishii M, Fujii H, Asami T, Yagi K, Suzuki S, Azekawa S, Tasaka S, Hasegawa N, Betsuyaku T", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" } ], "reference": [ { "type": "PubMed", "id": "30967261", "url": "https://glygen.org/publication/PubMed/30967261" } ] }, { "title": "The role of type 1 interferons in coagulation induced by gram-negative bacteria.", "journal": "Blood", "date": "2020", "authors": "Yang X, Cheng X, Tang Y, Qiu X, Wang Z, Fu G, Wu J, Kang H, Wang J, Wang H, Chen F, Xiao X, Billiar TR, Lu B", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" } ], "reference": [ { "type": "PubMed", "id": "32016282", "url": "https://glygen.org/publication/PubMed/32016282" } ] }, { "title": "Frontline Science: Estrogen-related receptor gamma increases poly(I:C)-mediated type I IFN expression in mouse macrophages.", "journal": "Journal of leukocyte biology", "date": "2021", "authors": "Kim KS, Kim DK, Na SY, Jung YS, Cho SJ, Kim J, Lee IK, Kim YH, Lee CH, Jeong WI, Jo EK, Choi HS", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" } ], "reference": [ { "type": "PubMed", "id": "33615540", "url": "https://glygen.org/publication/PubMed/33615540" } ] }, { "title": "Mechanism of SUMOylation-Mediated Regulation of Type I IFN Expression.", "journal": "Journal of molecular biology", "date": "2023-03-01", "authors": "Du Li, Liu Wei, Rosen Steven T, Chen Yuan", "evidence": [ { "database": "RefSeq", "id": "NP_034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034632" } ], "reference": [ { "type": "PubMed", "id": "36681180", "url": "https://glygen.org/publication/PubMed/36681180" } ] }, { "title": "Structure and expression of cloned murine IFN-alpha genes.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Weissmann C., Mantei N., Boll W., Shaw G.D., Taira H., Lengyel P.", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "reference": [ { "type": "PubMed", "id": "6188104", "url": "https://glygen.org/publication/PubMed/6188104" } ] }, { "title": "Characterisation and antiproliferative activity of an alpha-type murine interferon from embryonic fibroblasts.", "journal": "Biochim. Biophys. Acta", "date": "1996", "authors": "Aitken A., Learmonth M., Beare D., Mallucci L., Wells V.", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "reference": [ { "type": "PubMed", "id": "9244179", "url": "https://glygen.org/publication/PubMed/9244179" } ] } ], "pathway": [ { "id": "mmu:15962", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15962", "resource": "KEGG Pathway" }, { "id": "R-MMU-909733", "name": "Interferon alpha/beta signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-909733", "resource": "Reactome", "description": "Interferon alpha/beta signaling" }, { "id": "R-MMU-912694", "name": "Regulation of IFNA/IFNB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-912694", "resource": "Reactome", "description": "Regulation of IFNA/IFNB signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P01562-1", "protein_name": "Interferon alpha-1/13", "gene_name": "IFNA13", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE", "length": 188 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTNLKKGLRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" }, { "id": "P01572", "url": "https://omabrowser.org/oma/group/P01572/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKILRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P05011-1", "protein_name": "Interferon alpha-1", "gene_name": "Ifna1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARLCAFLMSLVVVSYWSACCLGCDLPHTHNLRNKRVFTLLAQMRRLSPVSCLKDRKYFGFPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGLQACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLRENKHSPCAWEVVKAEVWRALSSSANLMGRLREERNES", "length": 192 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE", "length": 189 }, "evidence": [ { "id": "45229459", "url": "http://www.informatics.jax.org/homology/45229459", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "regulation of defense response to virus by host", "id": "GO:0050691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050691", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "response to exogenous dsRNA", "id": "GO:0043330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043330", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "B cell proliferation", "id": "GO:0042100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042100", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "T cell activation involved in immune response", "id": "GO:0002286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002286", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "natural killer cell activation involved in immune response", "id": "GO:0002323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002323", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation of STAT protein", "id": "GO:0033141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033141", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" }, { "name": "type I interferon receptor binding", "id": "GO:0005132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005132", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P01572", "url": "https://www.uniprot.org/uniprot/P01572" }, { "database": "PubMed", "id": "15254193", "url": "https://glygen.org/publication/PubMed/15254193" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }