{ "uniprot_canonical_ac": "P01355-1", "uniprot_ac": "P01355", "uniprot_id": "CCKN_RAT", "mass": { "chemical_mass": 12841.0, "monoisotopic_mass": 12841.0 }, "refseq": { "ac": "NP_036961", "name": "cholecystokinin preproprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, "gene_names": [ { "name": "Cck", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01355", "id": "P01355" }, { "name": "Cck", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961", "id": "NP_036961" } ], "protein_names": [ { "name": "Cholecystokinin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01355" }, { "name": "CCK", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01355" }, { "name": "cholecystokinin preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961", "id": "NP_036961" } ], "function": [ { "annotation": "Results show that cholecystokinin promotes lipid storage in white adipose tissue by acting on adipocyte cholecystokinin-2 receptor", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, { "database": "PubMed", "id": "29339381", "url": "https://glygen.org/publication/PubMed/29339381" } ] }, { "annotation": "Study provides the first direct comparative and quantitative data showing that presynaptic GABAB receptors exert differential inhibition at cholecystokinin (CCK) and parvalbumin (PV) basket cell (BC) synapses, resulting from a higher surface expression of the receptor at all CCK BC terminals and a lower protein density present in a subpopulation of boutons of PV BCs.", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, { "database": "PubMed", "id": "28466358", "url": "https://glygen.org/publication/PubMed/28466358" } ] }, { "annotation": "The cholecystokinin receptor agonist, CCK-8, induces adiponectin production in rat white adipose tissue.", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, { "database": "PubMed", "id": "31012948", "url": "https://glygen.org/publication/PubMed/31012948" } ] }, { "annotation": "The critical role of CCK in the regulation of food intake and diet-induced obesity. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, { "database": "PubMed", "id": "33422646", "url": "https://glygen.org/publication/PubMed/33422646" } ] }, { "annotation": "The two projections from CCK(NTS) neurons reduce food intake through opposite motivational states; one pathway signals positive valence (CCK(NTS)-->paraventricular nucleus of the hypothalamus ) and the other signals negative valence (CCK(NTS)-->parabrachial nucleus).", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" }, { "database": "PubMed", "id": "28684275", "url": "https://glygen.org/publication/PubMed/28684275" } ] }, { "annotation": "This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355#function" }, { "database": "PubMed", "id": "12479974", "url": "https://glygen.org/publication/PubMed/12479974" } ] } ], "disease": [ { "disease_id": "DOID:11981", "recommended_name": { "id": "DOID:11981", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11981", "name": "morbid obesity", "description": "" }, "synonyms": [ { "id": "DOID:11981", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11981", "name": "Severe obesity", "description": "" } ], "evidence": [ { "id": "11981", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11981" } ] }, { "disease_id": "DOID:83", "recommended_name": { "id": "DOID:83", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:83", "name": "cataract", "description": "A lens disease characterized by clouding of the lens inside the eye which leads to a decrease in vision." }, "synonyms": [ { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1 multiple types", "description": "Any cataract (disease) in which the cause of the disease is a mutation in the GJA8 gene." }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CTRCT1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "Duffy linked cataract", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "GJA8 cataract (disease)", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract (disease) caused by mutation in GJA8", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types, with or without microcornea", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CAE1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CZP1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "zonular pulverulent cataract 1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, Duffy-linked", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, zonular pulverulent, 1", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "early-onset non-syndromic cataract", "description": "Early-onset non-syndromic cataract is a rare, genetic, non-syndromic developmental defect of the eye, with high clinical and genetic heterogeneity, most frequently characterized by bilateral, symmetrical, non-progressive cataracts which present at birth or in early-childhood. Additional ocular manifestations (e.g. anterior segment dysgenesis, colobomas, nystagmus, microcornea, microphthalmia, myopia) may be associated, however other organs/systems are usually not affected." }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "cataract, age-related nuclear", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "nuclear sclerosis of the lens", "description": "" }, { "id": "MIM:116200", "resource": "MIM", "url": "https://www.omim.org/entry/116200", "name": "Cataract 1, multiple types", "description": "Cataract 1, multiple types" } ], "evidence": [ { "id": "83", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:83" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cck", "url": "https://www.uniprot.org/uniprot/P01355", "locus": { "chromosome": "8", "start_pos": 121153500, "end_pos": 121160084, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019321", "url": "https://www.ensembl.org/id/ENSRNOG00000019321" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019321", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019321", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "25298", "url": "https://www.ncbi.nlm.nih.gov/gene/25298", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001651", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001651", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015499", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015499", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:25298", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25298", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YSGLCIC", "url": "https://omabrowser.org/oma/group/YSGLCIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5293435at2759", "url": "http://www.orthodb.org/?query=5293435at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10786", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10786", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10786:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10786:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00918", "url": "http://pfam.xfam.org/family/PF00918", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P01355", "url": "http://purl.obolibrary.org/obo/PR_P01355", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2288", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2288", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6ASM0", "url": "https://www.uniprot.org/uniprot/A0A8I6ASM0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ASM0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ASM0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01355-1", "url": "https://www.uniprot.org/uniprot/P01355-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS", "length": 115, "header": "sp|P01355-1|CCKN_RAT Isoform 1 of Cholecystokinin OS=Rattus norvegicus OX=10116 GN=Cck PE=1 SV=1 CANONICAL=P01355-1" }, "isoforms": [ { "isoform_ac": "A0A8I6ASM0-1", "url": "", "sequence": { "sequence": "MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARYIQQVRKVAWMVTSGWVLTWTSRAGLKHRRWASFLWSSVTQFPMAPRPDCVWLDCSLWPHVRS", "length": 127, "header": "tr|A0A8I6ASM0-1|CCKN_RAT Computationally mapped isoform of Cholecystokinin OS=Rattus norvegicus OX=10116 GN=Cck PE=1 SV=1 CANONICAL=P01355-1" }, "locus": { "chromosome": "8", "start_pos": 121158926, "end_pos": 121153853, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000102218.1", "url": "https://www.ensembl.org/id/ENSRNOT00000102218.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097411.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097411.1" } ] } }, { "isoform_ac": "P01355-1", "url": "", "sequence": { "sequence": "MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS", "length": 115, "header": "sp|P01355-1|CCKN_RAT Isoform 1 of Cholecystokinin OS=Rattus norvegicus OX=10116 GN=Cck PE=1 SV=1 CANONICAL=P01355-1" }, "locus": { "chromosome": "8", "start_pos": 121158926, "end_pos": 121153747, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000026159", "url": "https://www.ensembl.org/id/ENSRNOT00000026159" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000026159", "url": "https://www.ensembl.org/id/ENSRNOP00000026159" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Biosynthesis and processing of pro CCK: recent progress and future challenges.", "journal": "Life Sci.", "date": "2003", "authors": "Beinfeld M.C.", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "12479974", "url": "https://glygen.org/publication/PubMed/12479974" } ] }, { "title": "Differential surface density and modulatory effects of presynaptic GABAB receptors in hippocampal cholecystokinin and parvalbumin basket cells.", "journal": "Brain structure & function", "date": "2017", "authors": "Booker SA, Althof D, Degro CE, Watanabe M, Kulik A, Vida I", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" } ], "reference": [ { "type": "PubMed", "id": "28466358", "url": "https://glygen.org/publication/PubMed/28466358" } ] }, { "title": "A tale of two circuits: CCK(NTS) neuron stimulation controls appetite and induces opposing motivational states by projections to distinct brain regions.", "journal": "Neuroscience", "date": "2017", "authors": "Roman CW, Sloat SR, Palmiter RD", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" } ], "reference": [ { "type": "PubMed", "id": "28684275", "url": "https://glygen.org/publication/PubMed/28684275" } ] }, { "title": "Cholecystokinin is involved in triglyceride fatty acid uptake by rat adipose tissue.", "journal": "The Journal of endocrinology", "date": "2018", "authors": "Plaza A, Merino B, Cano V, Dominguez G, Perez-Castells J, Fernandez-Alfonso MS, Sengenes C, Chowen JA, Ruiz-Gayo M", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" } ], "reference": [ { "type": "PubMed", "id": "29339381", "url": "https://glygen.org/publication/PubMed/29339381" } ] }, { "title": "A gene encoding rat cholecystokinin. Isolation, nucleotide sequence, and promoter activity.", "journal": "J. Biol. Chem.", "date": "1985", "authors": "Deschenes RJ, Haun RS, Funckes CL, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "2981840", "url": "https://glygen.org/publication/PubMed/2981840" } ] }, { "title": "The cholecystokinin receptor agonist, CCK-8, induces adiponectin production in rat white adipose tissue.", "journal": "British journal of pharmacology", "date": "2019", "authors": "Plaza A, Merino B, Del Olmo N, Ruiz-Gayo M", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" } ], "reference": [ { "type": "PubMed", "id": "31012948", "url": "https://glygen.org/publication/PubMed/31012948" } ] }, { "title": "The critical role of CCK in the regulation of food intake and diet-induced obesity.", "journal": "Peptides", "date": "2021", "authors": "Cawthon CR, de La Serre CB", "evidence": [ { "database": "RefSeq", "id": "NP_036961", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036961" } ], "reference": [ { "type": "PubMed", "id": "33422646", "url": "https://glygen.org/publication/PubMed/33422646" } ] }, { "title": "Modulation of cholecystokinin gene expression.", "journal": "Ann. N. Y. Acad. Sci.", "date": "1985", "authors": "Dixon J.E., Roos B.A., Haun R.S., Deschenes R.J., Sunkel D.", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "3861130", "url": "https://glygen.org/publication/PubMed/3861130" } ] }, { "title": "Cloning and sequence analysis of a cDNA encoding rat preprocholecystokinin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1984", "authors": "Dixon J.E., Roos B.A., Haun R.S., Deschenes R.J., Collier K.J., Lorenz L.J.", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "6199787", "url": "https://glygen.org/publication/PubMed/6199787" } ] }, { "title": "Molecular cloning and nucleotide sequence of cDNA coding for rat brain cholecystokinin precursor.", "journal": "J. Biochem.", "date": "1984", "authors": "Kuwano R, Araki K, Usui H, Fukui T, Ohtsuka E, Ikehara M, Takahashi Y", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "6209267", "url": "https://glygen.org/publication/PubMed/6209267" } ] }, { "title": "Inhibition of pro-cholecystokinin (CCK) sulfation by treatment with sodium chlorate alters its processing and decreases cellular content and secretion of CCK 8.", "journal": "Neuropeptides", "date": "1994", "authors": "Beinfeld MC", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "reference": [ { "type": "PubMed", "id": "8208365", "url": "https://glygen.org/publication/PubMed/8208365" } ] } ], "pathway": [ { "id": "rno:25298", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:25298", "resource": "KEGG Pathway" }, { "id": "R-RNO-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-RNO-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P06307-1", "protein_name": "Cholecystokinin", "gene_name": "CCK", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS", "length": 115 }, "evidence": [ { "id": "45229507", "url": "http://www.informatics.jax.org/homology/45229507", "database": "MGI" }, { "id": "P01355", "url": "https://omabrowser.org/oma/group/P01355/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P09240-1", "protein_name": "Cholecystokinin", "gene_name": "Cck", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKSGVCLCVVMAVLAAGALAQPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS", "length": 115 }, "evidence": [ { "id": "45229507", "url": "http://www.informatics.jax.org/homology/45229507", "database": "MGI" }, { "id": "P01355", "url": "https://omabrowser.org/oma/group/P01355/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "GABA-ergic synapse", "id": "GO:0098982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098982", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "terminal bouton", "id": "GO:0043195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043195", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "axon initial segment", "id": "GO:0043194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043194", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "axon hillock", "id": "GO:0043203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043203", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "neuropeptide hormone activity", "id": "GO:0005184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "peptide hormone receptor binding", "id": "GO:0051428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051428", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 20, "go_terms": [ { "name": "digestion", "id": "GO:0007586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007586", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "negative regulation of eating behavior", "id": "GO:1903999", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903999", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "protein kinase C-activating G protein-coupled receptor signaling pathway", "id": "GO:0007205", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007205", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "memory", "id": "GO:0007613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007613", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "neuron migration", "id": "GO:0001764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001764", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of glutamate secretion", "id": "GO:0014049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014049", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "eating behavior", "id": "GO:0042755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042755", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "release of cytochrome c from mitochondria", "id": "GO:0001836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001836", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial depolarization", "id": "GO:0051901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051901", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "negative regulation of appetite", "id": "GO:0032099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032099", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "positive regulation of behavioral fear response", "id": "GO:2000987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000987", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "negative regulation of behavioral fear response", "id": "GO:2000986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000986", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" }, { "name": "synaptic signaling via neuropeptide", "id": "GO:0099538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099538", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Sulfation of Tyr-97 is essential for receptor activation.", "evidence": [ { "database": "UniProtKB", "id": "P01355", "url": "https://www.uniprot.org/uniprot/P01355" }, { "database": "PubMed", "id": "8208365", "url": "https://glygen.org/publication/PubMed/8208365" }, { "database": "PubMed", "id": "SIP9C94E1A3E5E5622C", "url": "https://glygen.org/publication/PubMed/SIP9C94E1A3E5E5622C" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }