{ "uniprot_canonical_ac": "P01173-1", "uniprot_ac": "P01173", "uniprot_id": "WAP_MOUSE", "mass": { "chemical_mass": 14423.0, "monoisotopic_mass": 14423.0 }, "refseq": { "ac": "NP_035839", "name": "whey acidic protein precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035839" }, "gene_names": [ { "name": "Wap", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01173", "id": "P01173" }, { "name": "Wap", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035839", "id": "NP_035839" } ], "protein_names": [ { "name": "Whey acidic protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01173" }, { "name": "WAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01173" }, { "name": "whey acidic protein precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035839", "id": "NP_035839" } ], "function": [ { "annotation": "Could be a protease inhibitor. May play an important role in mammary gland development and tissue remodeling.", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Wap", "url": "https://www.uniprot.org/uniprot/P01173", "locus": { "chromosome": "11", "start_pos": 6585482, "end_pos": 6588637, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000000381", "url": "https://www.ensembl.org/id/ENSMUSG00000000381" } ] } } ], "crossref": [ { "id": "ENSMUSG00000000381", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000000381", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00199", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00199", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22373", "url": "https://www.ncbi.nlm.nih.gov/gene/22373", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036645", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036645", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22373", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22373", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "98943", "url": "http://www.informatics.jax.org/marker/MGI:98943", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PQGTKCC", "url": "https://omabrowser.org/oma/group/PQGTKCC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4306065at2759", "url": "http://www.orthodb.org/?query=4306065at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF00095", "url": "http://pfam.xfam.org/family/PF00095", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P01173", "url": "http://purl.obolibrary.org/obo/PR_P01173", "database": "PRO", "categories": [ "Protein" ] }, { "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01173-1", "url": "https://www.uniprot.org/uniprot/P01173-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7M748", "url": "https://www.uniprot.org/uniprot/Q7M748", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7M748-1", "url": "https://www.uniprot.org/uniprot/Q7M748-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRCLISLVLGLLALEVALAQNLEEQVFNSVQSMFQKASPIEGTECIICQTNEECAQNAMCCPGSCGRTRKTPVNIGVPKAGFCPWNLLQTISSTGPCPMKIECSSDRECSGNMKCCNVDCVMTCTPPVPVITLQ", "length": 134, "header": "sp|P01173-1|WAP_MOUSE Isoform 1 of Whey acidic protein OS=Mus musculus OX=10090 GN=Wap PE=1 SV=3 CANONICAL=P01173-1" }, "isoforms": [ { "isoform_ac": "P01173-1", "url": "", "sequence": { "sequence": "MRCLISLVLGLLALEVALAQNLEEQVFNSVQSMFQKASPIEGTECIICQTNEECAQNAMCCPGSCGRTRKTPVNIGVPKAGFCPWNLLQTISSTGPCPMKIECSSDRECSGNMKCCNVDCVMTCTPPVPVITLQ", "length": 134, "header": "sp|P01173-1|WAP_MOUSE Isoform 1 of Whey acidic protein OS=Mus musculus OX=10090 GN=Wap PE=1 SV=3 CANONICAL=P01173-1" }, "locus": {} }, { "isoform_ac": "Q7M748-1", "url": "", "sequence": { "sequence": "MRCLISLVLGLLALEVALAQNLEEQVFNSVQSMFPKASPIEGTECIICQTNEECAQNAMCCPGSCGRTRKTPVNIGVPKAGFCPWNLLQMISSTGPCPMKIECSSDRECSGNMKCCNVDCVMTCTPPVPVITLQ", "length": 134, "header": "tr|Q7M748-1|Q7M748_MOUSE Computationally mapped isoform of Whey acidic protein OS=Mus musculus OX=10090 GN=Wap PE=2 SV=1 CANONICAL=P01173-1" }, "locus": { "chromosome": "11", "start_pos": 6588622, "end_pos": 6585616, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102910.4", "url": "https://www.ensembl.org/id/ENSMUST00000102910.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099974.4", "url": "https://www.ensembl.org/id/ENSMUSP00000099974.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Hormone-induced modifications of the chromatin structure surrounding upstream regulatory regions conserved between the mouse and rabbit whey acidic protein genes.", "journal": "Biochem. J.", "date": "2003", "authors": "Montoliu L., Devinoy E., Fontaine M.L., Mata T., Millot B.", "evidence": [ { "database": "UniProtKB", "id": "Q7M748", "url": "https://www.uniprot.org/uniprot/Q7M748" } ], "reference": [ { "type": "PubMed", "id": "12580766", "url": "https://glygen.org/publication/PubMed/12580766" } ] }, { "title": "Expression of the whey acidic protein (Wap) is necessary for adequate nourishment of the offspring but not functional differentiation of mammary epithelial cells.", "journal": "Genesis", "date": "2005", "authors": "Triplett AA, Sakamoto K, Matulka LA, Shen L, Smith GH, Wagner KU", "evidence": [ { "database": "UniProtKB", "id": "Q7M748", "url": "https://www.uniprot.org/uniprot/Q7M748" } ], "reference": [ { "type": "PubMed", "id": "16106354", "url": "https://glygen.org/publication/PubMed/16106354" } ] }, { "title": "Comparison of the whey acidic protein genes of the rat and mouse.", "journal": "Nucleic Acids Res.", "date": "1984", "authors": "Sippel A.E., Rosen J.M., Hennighausen L.G., Campbell S.M., Strech-Jurk U.", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "reference": [ { "type": "PubMed", "id": "6095207", "url": "https://glygen.org/publication/PubMed/6095207" } ] }, { "title": "Mouse whey acidic protein is a novel member of the family of 'four-disulfide core' proteins.", "journal": "Nucleic Acids Res.", "date": "1982", "authors": "Sippel A.E., Hennighausen L.G.", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "reference": [ { "type": "PubMed", "id": "6896234", "url": "https://glygen.org/publication/PubMed/6896234" } ] }, { "title": "Biochemical characterization of a novel whey protein from murine milk.", "journal": "J. Biol. Chem.", "date": "1981", "authors": "Ganschow R.E., Piletz J.E., Heinlen M.", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "reference": [ { "type": "PubMed", "id": "6975276", "url": "https://glygen.org/publication/PubMed/6975276" } ] } ], "pathway": [ { "id": "mmu:22373", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22373", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P01174-1", "protein_name": "Whey acidic protein", "gene_name": "Wap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCSDDSFSEDTECINCQTNEECAQNDMCCPSSCGRSCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCKNGCIMSCMDPEPKSPTVISFQ", "length": 137 }, "evidence": [ { "id": "45245736", "url": "http://www.informatics.jax.org/homology/45245736", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "negative regulation of peptidase activity", "id": "GO:0010466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010466", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" }, { "name": "nutrient reservoir activity", "id": "GO:0045735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045735", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" }, { "name": "peptidase inhibitor activity", "id": "GO:0030414", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030414", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01173", "url": "https://www.uniprot.org/uniprot/P01173" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }