{ "uniprot_canonical_ac": "P00417-1", "uniprot_ac": "P00417", "uniprot_id": "COX3_DROME", "mass": { "chemical_mass": 30064.0, "monoisotopic_mass": 30064.0 }, "refseq": { "ac": "YP_009047271", "name": "cytochrome c oxidase subunit III", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_009047271" }, "gene_names": [ { "name": "mt:CoIII", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P00417", "id": "P00417" }, { "name": "COX3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_009047271", "id": "YP_009047271" }, { "name": "CoIII", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P00417", "id": "P00417" }, { "name": "mt:CoIII", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_009047271", "id": "YP_009047271" } ], "protein_names": [ { "name": "Cytochrome c oxidase subunit 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P00417" }, { "name": "7.1.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00417" }, { "name": "Cytochrome c oxidase polypeptide III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P00417" }, { "name": "cytochrome c oxidase subunit III", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_009047271", "id": "YP_009047271" } ], "function": [ { "annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417#function" }, { "database": "UniProtKB", "id": "P00420", "url": "https://www.uniprot.org/uniprot/P00420#function" } ] } ], "disease": [ { "disease_id": "DOID:3687", "recommended_name": { "id": "DOID:3687", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3687", "name": "MELAS syndrome", "description": "A mitochondrial encephalomyopathy that is characterized by mitochondrial myopathy, encephalopathy, lactic acidosis, and stroke-like episodes, has_symptom myalgia, motor weakness, headaches, seizures, and stroke-like episodes with acute hemiparesis and severe headaches, and develops_from mutation in mitochondrial genes including MT-TL1, which encodes tRNA proteins." }, "synonyms": [ { "id": "DOID:3687", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3687", "name": "MITOCHONDRIAL MYOPATHY, ENCEPHALOPATHY, LACTIC ACIDOSIS, AND STROKE-LIKE EPISODES", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "MELAS syndrome", "description": "MELAS (Mitochondrial myopathy, encephalopathy, lactic acidosis, and stroke) syndrome is a rare progressive multisystemic disorder characterized by encephalomyopathy, lactic acidosis, and stroke-like episodes. Other features include endocrinopathy, heart disease, diabetes, hearing loss, and neurological and psychiatric manifestations." }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "MELAS syndrome", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "mitochondrial encephalomyopathy, lactic acidosis and stroke", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "mitochondrial myopathy, encephalopathy, lactic acidosis and stroke-like episodes", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "mitochondrial myopathy, encephalopathy, lactic acidosis, and stroke-like episodes", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "MELAS", "description": "" }, { "id": "MONDO:0010789", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010789", "name": "mitochondrial encephalomyopathy lactic acidosis and stroke-like episodes", "description": "" }, { "id": "MIM:540000", "resource": "MIM", "url": "https://www.omim.org/entry/540000", "name": "Mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome", "description": "Mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome" } ], "evidence": [ { "id": "3687", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3687" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "mt:CoIII", "url": "https://www.uniprot.org/uniprot/P00417", "locus": { "chromosome": "mitochondrion_genome", "start_pos": 5524, "end_pos": 4736, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0013676", "url": "https://www.ensembl.org/id/FBgn0013676" } ] } } ], "crossref": [ { "id": "FBgn0013676", "url": "https://bgee.org/?page=gene&gene_id=FBgn0013676", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01665", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01665", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0013676", "url": "https://flybase.org/reports/FBgn0013676", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "19893540", "url": "https://www.ncbi.nlm.nih.gov/gene/19893540", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013833", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013833", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024791", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024791", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033945", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033945", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035973", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035973", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG34074", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG34074", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SIYWWGS", "url": "https://omabrowser.org/oma/group/SIYWWGS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "984876at2759", "url": "http://www.orthodb.org/?query=984876at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11403", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11403:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00510", "url": "http://pfam.xfam.org/family/PF00510", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P00417", "url": "http://purl.obolibrary.org/obo/PR_P00417", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-5628897", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9707564", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "YP_009047271", "url": "https://www.ncbi.nlm.nih.gov/protein/YP_009047271", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11436", "url": "https://www.rhea-db.org/rhea/11436", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P00417-1", "url": "https://www.uniprot.org/uniprot/P00417-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTHSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWGG", "length": 262, "header": "sp|P00417-1|COX3_DROME Isoform 1 of Cytochrome c oxidase subunit 3 OS=Drosophila melanogaster OX=7227 GN=mt:CoIII PE=3 SV=1 CANONICAL=P00417-1" }, "isoforms": [ { "isoform_ac": "P00417-1", "url": "", "sequence": { "sequence": "MSTHSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWGG", "length": 262, "header": "sp|P00417-1|COX3_DROME Isoform 1 of Cytochrome c oxidase subunit 3 OS=Drosophila melanogaster OX=7227 GN=mt:CoIII PE=3 SV=1 CANONICAL=P00417-1" }, "locus": { "chromosome": "mitochondrion_genome", "start_pos": 5521, "end_pos": 4736, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0100868", "url": "https://www.ensembl.org/id/FBtr0100868" }, { "database": "Ensembl Peptide", "id": "FBpp0100180", "url": "https://www.ensembl.org/id/FBpp0100180" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Comparative genomics of mitochondrial DNA in members of the Drosophila melanogaster subgroup.", "journal": "J. Mol. Evol.", "date": "2000", "authors": "Ballard JW", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "10903372", "url": "https://glygen.org/publication/PubMed/10903372" } ] }, { "title": "I-R system of hybrid dysgenesis in Drosophila melanogaster: analysis of the mitochondrial DNA in reactive strains exhibiting different potentials for I factor transposition.", "journal": "Heredity", "date": "2001", "authors": "Azou Y., Bregliano J.C.", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "11298822", "url": "https://glygen.org/publication/PubMed/11298822" } ] }, { "title": "Out of Hawaii: the origin and biogeography of the genus Scaptomyza (Diptera: Drosophilidae).", "journal": "Biol. Lett.", "date": "2008", "authors": "DeSalle R., O'Grady P.M.", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "18296276", "url": "https://glygen.org/publication/PubMed/18296276" } ] }, { "title": "Drosophila melanogaster mitochondrial DNA: gene organization and evolutionary considerations.", "journal": "Genetics", "date": "1988", "authors": "Garesse R.", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "3130291", "url": "https://glygen.org/publication/PubMed/3130291" } ] }, { "title": "Transfer RNA genes in Drosophila mitochondrial DNA: related 5' flanking sequences and comparisons to mammalian mitochondrial tRNA genes.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Clary D.O., Wolstenholme D.R., Wahleithner J.A.", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "6304652", "url": "https://glygen.org/publication/PubMed/6304652" } ] }, { "title": "Drosophila melanogaster mitochondrial DNA, a novel organization and genetic code.", "journal": "Nature", "date": "1983", "authors": "de Bruijn MH", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "6408489", "url": "https://glygen.org/publication/PubMed/6408489" } ] }, { "title": "Drosophila melanogaster mitochondrial DNA: completion of the nucleotide sequence and evolutionary comparisons.", "journal": "Insect Mol. Biol.", "date": "1995", "authors": "Lewis DL, Farr CL, Kaguni LS", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "reference": [ { "type": "PubMed", "id": "8825764", "url": "https://glygen.org/publication/PubMed/8825764" } ] } ], "pathway": [ { "id": "dme:Dmel_CG34074", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG34074", "resource": "KEGG Pathway" }, { "id": "R-DME-5628897", "name": "TP53 Regulates Metabolic Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5628897", "resource": "Reactome", "description": "TP53 Regulates Metabolic Genes" }, { "id": "R-DME-611105", "name": "Respiratory electron transport", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-611105", "resource": "Reactome", "description": "Respiratory electron transport" }, { "id": "R-DME-9707564", "name": "Cytoprotection by HMOX1", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9707564", "resource": "Reactome", "description": "Cytoprotection by HMOX1" } ], "orthologs": [ { "uniprot_canonical_ac": "P00414-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "MT-CO3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS", "length": 261 }, "evidence": [ { "id": "P00417", "url": "https://omabrowser.org/oma/group/P00417/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P00416-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "mt-Co3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS", "length": 261 }, "evidence": [ { "id": "P00417", "url": "https://omabrowser.org/oma/group/P00417/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00420-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "COX3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV", "length": 269 }, "evidence": [ { "id": "P00417", "url": "https://omabrowser.org/oma/group/P00417/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P05505-1", "protein_name": "Cytochrome c oxidase subunit 3", "gene_name": "Mtco3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTHQTHAYHMVNPSPWPLTGALSALLLTSGLVMWFHYNSTILLSLGLLTNILTMYQWWRDIIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHMNQALLITILLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS", "length": 261 }, "evidence": [ { "id": "P00417", "url": "https://omabrowser.org/oma/group/P00417/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cytochrome-c oxidase activity", "id": "GO:0004129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004129", "evidence": [ { "database": "UniProtKB", "id": "P00417", "url": "https://www.uniprot.org/uniprot/P00417" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 156, "end_pos": 158, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11436", "name": "", "equation": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P05505-1", "P00406-1", "P05503-1", "P00395-1", "P00414-1", "P00403-1", "P00416-1", "P00397-1", "P00405-1", "P00401-1", "P00410-1", "P00420-1", "O21049-1", "O21042-1", "P20609-1", "P20610-1", "P30815-1", "P00417-1", "P00408-1", "P00399-1" ], "evidence": [ { "id": "11436", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11436" } ] }, { "id": "R-DME-163214", "name": "Electron transfer from reduced cytochrome c to molecular oxygen", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00417-1", "P00399-1", "P00408-1", "Q9VHR9-1" ], "evidence": [ { "id": "R-DME-163214", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-163214" } ] }, { "id": "R-DME-9709406", "name": "CO binds to Cytochrome c oxidase", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00417-1", "P00399-1", "P00408-1", "Q9VHR9-1" ], "evidence": [ { "id": "R-DME-9709406", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9709406" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O21042", "gene_name": "2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "O21042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21042" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "O21042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21042" } ] } ] }, { "uniprot_ac": "O21049", "gene_name": "cox3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "O21049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21049" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "O21049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21049" } ] } ] }, { "uniprot_ac": "P00395", "gene_name": "MT-CO1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00395" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00395" } ] } ] }, { "uniprot_ac": "P00397", "gene_name": "Mtco1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00397" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00397" } ] } ] }, { "uniprot_ac": "P00399", "gene_name": "mt:CoI", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00399", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00399" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00399", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00399" } ] } ] }, { "uniprot_ac": "P00401", "gene_name": "COX1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00401" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00401" } ] } ] }, { "uniprot_ac": "P00403", "gene_name": "MT-CO2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00403" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00403" } ] } ] }, { "uniprot_ac": "P00405", "gene_name": "Mtco2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00405" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00405" } ] } ] }, { "uniprot_ac": "P00406", "gene_name": "Mtco2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00406" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00406" } ] } ] }, { "uniprot_ac": "P00408", "gene_name": "mt:CoII", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00408" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00408" } ] } ] }, { "uniprot_ac": "P00410", "gene_name": "COX2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00410" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00410" } ] } ] }, { "uniprot_ac": "P00414", "gene_name": "MT-CO3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00414" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00414" } ] } ] }, { "uniprot_ac": "P00416", "gene_name": "mt-Co3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00416", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00416" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00416", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00416" } ] } ] }, { "uniprot_ac": "P00417", "gene_name": "mt:CoIII", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00417" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00417" } ] } ] }, { "uniprot_ac": "P00420", "gene_name": "COX3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00420" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00420" } ] } ] }, { "uniprot_ac": "P05503", "gene_name": "Mtco1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P05503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05503" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P05503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05503" } ] } ] }, { "uniprot_ac": "P05505", "gene_name": "Mtco3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P05505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05505" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P05505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05505" } ] } ] }, { "uniprot_ac": "P20609", "gene_name": "cxgE", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P20609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20609" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P20609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20609" } ] } ] }, { "uniprot_ac": "P20610", "gene_name": "cxgS", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P20610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20610" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P20610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20610" } ] } ] }, { "uniprot_ac": "P30815", "gene_name": "cxdA", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P30815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30815" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P30815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30815" } ] } ] }, { "uniprot_ac": "Q9VHR9", "gene_name": "COX7AL", "activity": [ { "ec_number": "1.9.3.1", "activity": "", "evidence": [ { "id": "Q9VHR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHR9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }