{ "uniprot_canonical_ac": "O89094-1", "uniprot_ac": "O89094", "uniprot_id": "CASPE_MOUSE", "mass": { "chemical_mass": 29458.0, "monoisotopic_mass": 29458.0 }, "refseq": { "ac": "NP_033939", "name": "caspase-14", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939" }, "gene_names": [ { "name": "Casp14", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O89094", "id": "O89094" }, { "name": "Casp14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939", "id": "NP_033939" }, { "name": "MICE; mini-ICE", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939", "id": "NP_033939" } ], "protein_names": [ { "name": "Caspase-14", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O89094" }, { "name": "3.4.22.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O89094" }, { "name": "CASP-14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939", "id": "NP_033939" }, { "name": "CASP-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O89094" }, { "name": "MICE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O89094" }, { "name": "Mini-ICE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O89094" }, { "name": "caspase-14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939", "id": "NP_033939" } ], "function": [ { "annotation": "Non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and is required for cornification (PubMed:18156206). Regulates maturation of the epidermis by proteolytically processing filaggrin (PubMed:21654840). In vitro is equally active on the synthetic caspase substrates WEHD-ACF and IETD-AFC. Involved in processing of prosaposin in the epidermis (PubMed:24872419). May be involved in retinal pigment epithelium cell barrier function (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094#function" }, { "database": "PubMed", "id": "21654840", "url": "https://glygen.org/publication/PubMed/21654840" }, { "database": "PubMed", "id": "18156206", "url": "https://glygen.org/publication/PubMed/18156206" }, { "database": "PubMed", "id": "17515931", "url": "https://glygen.org/publication/PubMed/17515931" }, { "database": "UniProtKB", "id": "P31944", "url": "https://www.uniprot.org/uniprot/P31944#function" }, { "database": "PubMed", "id": "11175259", "url": "https://glygen.org/publication/PubMed/11175259" }, { "database": "PubMed", "id": "24872419", "url": "https://glygen.org/publication/PubMed/24872419" } ] }, { "annotation": "Processing of caspase 14 in epidermal differentiation", "evidence": [ { "database": "RefSeq", "id": "NP_033939", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939" }, { "database": "PubMed", "id": "12200134", "url": "https://glygen.org/publication/PubMed/12200134" } ] } ], "disease": [ { "disease_id": "DOID:0060655", "recommended_name": { "id": "DOID:0060655", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060655", "name": "autosomal recessive congenital ichthyosis", "description": "An ichthyosis that is characterized by autosomal recessive inheritance and abnormal skin scaling over the whole body due to a defect in keratinization." }, "synonyms": [ { "id": "DOID:0060655", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060655", "name": "ARCI", "description": "" }, { "id": "DOID:0060655", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060655", "name": "lamellar ichthyosis", "description": "" }, { "id": "DOID:0060655", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060655", "name": "non bullous congenital ichthyosiform erythroderma", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "autosomal recessive congenital ichthyosis 1", "description": "Any autosomal recessive congenital ichthyosis in which the cause of the disease is a mutation in the TGM1 gene." }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ARCI1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "autosomal recessive congenital ichthyosis 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "autosomal recessive congenital ichthyosis type 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis, congenital, autosomal recessive type 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "bathing suit ichthyosis", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "LI1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "collodion baby, self-healing", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "collodion fetus", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "collodion foetus", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "desquamation of newborn", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis congenita", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis congenita 2", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis lamellar 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis, congenital, autosomal recessive 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis, congenital, autosomal recessive 1, with bathing suit distribution", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis, lamellar, 1", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "ichthyosis, lamellar, 1, formerly", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "lamellar exfoliation of newborn", "description": "" }, { "id": "MONDO:0009441", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009441", "name": "lamellar ichthyosis, type 1", "description": "" }, { "id": "MIM:242300", "resource": "MIM", "url": "https://www.omim.org/entry/242300", "name": "Ichthyosis, congenital, autosomal recessive 1", "description": "Ichthyosis, congenital, autosomal recessive 1" } ], "evidence": [ { "id": "0060655", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060655" } ] }, { "disease_id": "DOID:2998", "recommended_name": { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "testicular cancer", "description": "A male reproductive system cancer that is located_in the testicles." }, "synonyms": [ { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "childhood neoplasm of the testis", "description": "" }, { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "neoplasm of testis", "description": "" }, { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "pediatric testicular neoplasm", "description": "" }, { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "testicular tumor", "description": "" }, { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "testis cancer", "description": "" }, { "id": "DOID:2998", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2998", "name": "testis neoplasm", "description": "" } ], "evidence": [ { "id": "2998", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2998" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 136, "end_pos": 136, "sequence_org": "C", "sequence_mut": "A", "comment": "Decrease in death-inducing activity.", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" }, { "database": "PubMed", "id": "9792675", "url": "https://glygen.org/publication/PubMed/9792675" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Casp14", "url": "https://www.uniprot.org/uniprot/O89094", "locus": { "chromosome": "10", "start_pos": 78547825, "end_pos": 78554128, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000005355", "url": "https://www.ensembl.org/id/ENSMUSG00000005355" } ] } } ], "crossref": [ { "id": "ENSMUSG00000005355", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000005355", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00032", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00032", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "12365", "url": "https://www.ncbi.nlm.nih.gov/gene/12365", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001309", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001309", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011600", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011600", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015917", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015917", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033139", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033139", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12365", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12365", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1335092", "url": "http://www.informatics.jax.org/marker/MGI:1335092", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IMMIAKD", "url": "https://omabrowser.org/oma/group/IMMIAKD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2873736at2759", "url": "http://www.orthodb.org/?query=2873736at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10454", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10454", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10454:SF131", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10454:SF131", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00656", "url": "http://pfam.xfam.org/family/PF00656", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O89094", "url": "http://purl.obolibrary.org/obo/PR_O89094", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_033939", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O89094-1", "url": "https://www.uniprot.org/uniprot/O89094-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O89094-2", "url": "https://www.uniprot.org/uniprot/O89094-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSILELTEEITRLMANTEVMQEGKPRKVNPEVQSTLRKKLYLQ", "length": 257, "header": "sp|O89094-1|CASPE_MOUSE Isoform 1 of Caspase-14 OS=Mus musculus OX=10090 GN=Casp14 PE=1 SV=1 CANONICAL=O89094-1" }, "isoforms": [ { "isoform_ac": "O89094-1", "url": "", "sequence": { "sequence": "MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSILELTEEITRLMANTEVMQEGKPRKVNPEVQSTLRKKLYLQ", "length": 257, "header": "sp|O89094-1|CASPE_MOUSE Isoform 1 of Caspase-14 OS=Mus musculus OX=10090 GN=Casp14 PE=1 SV=1 CANONICAL=O89094-1" }, "locus": { "chromosome": "10", "start_pos": 78551692, "end_pos": 78549174, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000005488", "url": "https://www.ensembl.org/id/ENSMUST00000005488" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000005488", "url": "https://www.ensembl.org/id/ENSMUSP00000005488" } ] } }, { "isoform_ac": "O89094-2", "url": "", "sequence": { "sequence": "MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGDHPTYGKHGGDAGRKTKESEP", "length": 159, "header": "sp|O89094-2|CASPE_MOUSE Isoform 2 of Caspase-14 OS=Mus musculus OX=10090 GN=Casp14 PE=1 SV=1 CANONICAL=O89094-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Identification of a new caspase homologue: caspase-14.", "journal": "Cell Death Differ.", "date": "1998", "authors": "Vandenabeele P., Declercq W., Molemans F., Fiers W., Van Criekinge W., Pype S., Van Loo G., Van de Craen M., Van den brande I.", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "10203698", "url": "https://glygen.org/publication/PubMed/10203698" } ] }, { "title": "Epidermal differentiation does not involve the pro-apoptotic executioner caspases, but is associated with caspase-14 induction and processing.", "journal": "Cell Death Differ.", "date": "2000", "authors": "Vandenabeele P., Huylebroeck D., Kockx M., Zwijsen A., Declercq W., Lippens S., Formstecher P., Garmyn M., Knaapen M., Mortier L., Polakowska R., Verheyen A.", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "11175259", "url": "https://glygen.org/publication/PubMed/11175259" } ] }, { "title": "Caspase-14, a keratinocyte specific caspase: mRNA splice variants and expression pattern in embryonic and adult mouse.", "journal": "Cell Death Differ.", "date": "2001", "authors": "Dale B.A., Fleckman P., Kuechle M.K., Presland R.B., Predd H.M.", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "11526440", "url": "https://glygen.org/publication/PubMed/11526440" } ] }, { "title": "Processing of native caspase-14 occurs at an atypical cleavage site in normal epidermal differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Chien AJ, Presland RB, Kuechle MK", "evidence": [ { "database": "RefSeq", "id": "NP_033939", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033939" } ], "reference": [ { "type": "PubMed", "id": "12200134", "url": "https://glygen.org/publication/PubMed/12200134" } ] }, { "title": "Caspase-14 protects against epidermal UVB photodamage and water loss.", "journal": "Nat. Cell Biol.", "date": "2007", "authors": "Denecker G, Hoste E, Gilbert B, Hochepied T, Ovaere P, Lippens S, Van den Broecke C, Van Damme P, D'Herde K, Hachem JP, Borgonie G, Presland RB, Schoonjans L, Libert C, Vandekerckhove J, Gevaert K, Vandenabeele P, Declercq W", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "17515931", "url": "https://glygen.org/publication/PubMed/17515931" } ] }, { "title": "Acute modulations in permeability barrier function regulate epidermal cornification: role of caspase-14 and the protease-activated receptor type 2.", "journal": "Am. J. Pathol.", "date": "2008", "authors": "Elias P.M., Houben E., Vandenabeele P., Mauro T., Declercq W., Tschachler E., Denecker G., Feingold K.R., Hachem J.P., Crumrine D., Demerjian M., Hupe M., Roelandt T.", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "18156206", "url": "https://glygen.org/publication/PubMed/18156206" } ] }, { "title": "Caspase-14 is required for filaggrin degradation to natural moisturizing factors in the skin.", "journal": "J. Invest. Dermatol.", "date": "2011", "authors": "Hoste E, Kemperman P, Devos M, Denecker G, Kezic S, Yau N, Gilbert B, Lippens S, De Groote P, Roelandt R, Van Damme P, Gevaert K, Presland RB, Takahara H, Puppels G, Caspers P, Vandenabeele P, Declercq W", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "21654840", "url": "https://glygen.org/publication/PubMed/21654840" } ] }, { "title": "Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation.", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Yamamoto-Tanaka M, Motoyama A, Miyai M, Matsunaga Y, Matsuda J, Tsuboi R, Hibino T", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "24872419", "url": "https://glygen.org/publication/PubMed/24872419" } ] }, { "title": "Caspase-14 is a novel developmentally regulated protease.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Hu S, Snipas SJ, Vincenz C, Salvesen G, Dixit VM", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "9792675", "url": "https://glygen.org/publication/PubMed/9792675" } ] }, { "title": "Identification and characterization of murine caspase-14, a new member of the caspase family.", "journal": "Cancer Res.", "date": "1998", "authors": "Ahmad M, Srinivasula SM, Hegde R, Mukattash R, Fernandes-Alnemri T, Alnemri ES", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "reference": [ { "type": "PubMed", "id": "9823333", "url": "https://glygen.org/publication/PubMed/9823333" } ] } ], "pathway": [ { "id": "mmu:12365", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12365", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZZ65-1", "protein_name": "Caspase 14", "gene_name": "Casp14", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSETINPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKGSGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLRKKLYLQ", "length": 246 }, "evidence": [ { "id": "45240651", "url": "http://www.informatics.jax.org/homology/45240651", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "cornified envelope", "id": "GO:0001533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001533", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "keratin filament", "id": "GO:0045095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045095", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "peptidase activity", "id": "GO:0008233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase activity", "id": "GO:0004197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004197", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Maturation by proteolytic processing appears to be a two-step process. The precursor is processed by KLK7 to yield the p20/p8 intermediate form which acts the precursor to yield the p17/p10 mature form (By similarity). Initially it was reported that cleavage by granzyme B, caspase-8 and -10 generates the two active subunits, however the physiological relevance has not been established (PubMed:9823333).", "evidence": [ { "database": "UniProtKB", "id": "O89094", "url": "https://www.uniprot.org/uniprot/O89094" }, { "database": "PubMed", "id": "P31944", "url": "https://glygen.org/publication/PubMed/P31944" }, { "database": "PubMed", "id": "9823333", "url": "https://glygen.org/publication/PubMed/9823333" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }