{ "uniprot_canonical_ac": "O88856-1", "uniprot_ac": "O88856", "uniprot_id": "TPST2_MOUSE", "mass": { "chemical_mass": 42067.0, "monoisotopic_mass": 42067.0 }, "refseq": { "ac": "NP_001313519", "name": "protein-tyrosine sulfotransferase 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519" }, "gene_names": [ { "name": "Tpst2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O88856", "id": "O88856" }, { "name": "D5Ucla3; grm; grt; Tango13b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519", "id": "NP_001313519" }, { "name": "D5ucla3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O88856", "id": "O88856" }, { "name": "Tpst2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519", "id": "NP_001313519" } ], "protein_names": [ { "name": "Protein-tyrosine sulfotransferase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O88856" }, { "name": "2.8.2.20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88856" }, { "name": "TPST-2; tyrosylprotein sulfotransferase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519", "id": "NP_001313519" }, { "name": "TPST-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88856" }, { "name": "Tyrosylprotein sulfotransferase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88856" }, { "name": "protein-tyrosine sulfotransferase 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519", "id": "NP_001313519" } ], "function": [ { "annotation": "Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.", "evidence": [ { "database": "UniProtKB", "id": "Q3TQN1", "url": "https://www.uniprot.org/uniprot/Q3TQN1#function" }, { "database": "UniProtKB", "id": "ARBA00003886", "url": "https://www.uniprot.org/uniprot/ARBA00003886#function" }, { "database": "UniProtKB", "id": "RU365018", "url": "https://www.uniprot.org/uniprot/RU365018#function" }, { "database": "UniProtKB", "id": "A0A0G2JE92", "url": "https://www.uniprot.org/uniprot/A0A0G2JE92#function" }, { "database": "UniProtKB", "id": "F7BM44", "url": "https://www.uniprot.org/uniprot/F7BM44#function" }, { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856#function" }, { "database": "PubMed", "id": "9733778", "url": "https://glygen.org/publication/PubMed/9733778" } ] }, { "annotation": "Cerebral abnormalities in grt/grt Tpst2 gene defect mice are characterized by cortical hypoplasia at the frontooccipital axis with immature pyramidal neurons and insufficient development of callosal fibers", "evidence": [ { "database": "RefSeq", "id": "NP_001313519", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519" }, { "database": "PubMed", "id": "25231844", "url": "https://glygen.org/publication/PubMed/25231844" } ] }, { "annotation": "TPST2-mediated receptor tyrosine sulfation enhances leukocidin cytotoxicity and S. aureus infection. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001313519", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519" }, { "database": "PubMed", "id": "37671153", "url": "https://glygen.org/publication/PubMed/37671153" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tpst2", "url": "https://www.uniprot.org/uniprot/O88856", "locus": { "chromosome": "5", "start_pos": 112463227, "end_pos": 112424557, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000029344", "url": "https://www.ensembl.org/id/ENSMUSG00000029344" } ] } } ], "crossref": [ { "id": "ENSMUSG00000029344", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029344", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "22022", "url": "https://www.ncbi.nlm.nih.gov/gene/22022", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0001278", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0001278", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0003230", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003230", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0004340", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0004340", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR026634", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026634", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22022", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22022", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1309516", "url": "http://www.informatics.jax.org/marker/MGI:1309516", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HFLELQW", "url": "https://omabrowser.org/oma/group/HFLELQW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5391764at2759", "url": "http://www.orthodb.org/?query=5391764at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12788", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12788", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12788:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12788:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13469", "url": "http://pfam.xfam.org/family/PF13469", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O88856", "url": "http://purl.obolibrary.org/obo/PR_O88856", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-156584", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156584", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-163841", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-163841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001313519", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16801", "url": "https://www.rhea-db.org/rhea/16801", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JE92", "url": "https://www.uniprot.org/uniprot/A0A0G2JE92", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JE92-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JE92-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YV96", "url": "https://www.uniprot.org/uniprot/D3YV96", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YV96-1", "url": "https://www.uniprot.org/uniprot/D3YV96-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7BM44", "url": "https://www.uniprot.org/uniprot/F7BM44", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7BM44-1", "url": "https://www.uniprot.org/uniprot/F7BM44-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88856-1", "url": "https://www.uniprot.org/uniprot/O88856-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TQN1", "url": "https://www.uniprot.org/uniprot/Q3TQN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TQN1-1", "url": "https://www.uniprot.org/uniprot/Q3TQN1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLSVRKVLLAAGCALALVLAVQLGQQVLECRAVLGGTRNPRRMRPEQEELVMLGADHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS", "length": 376, "header": "sp|O88856-1|TPST2_MOUSE Isoform 1 of Protein-tyrosine sulfotransferase 2 OS=Mus musculus OX=10090 GN=Tpst2 PE=1 SV=1 CANONICAL=O88856-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JE92-1", "url": "", "sequence": { "sequence": "XRTVRAGSRGDQARGLVLENEGAQGRIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS", "length": 122, "header": "tr|A0A0G2JE92-1|TPST2_MOUSE Computationally mapped isoform of Protein-tyrosine sulfotransferase 2 OS=Mus musculus OX=10090 GN=Tpst2 PE=1 SV=1 CANONICAL=O88856-1" }, "locus": { "chromosome": "5", "start_pos": 112461147, "end_pos": 112451762, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000198502.2", "url": "https://www.ensembl.org/id/ENSMUST00000198502.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142679.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142679.2" } ] } }, { "isoform_ac": "D3YV96-1", "url": "", "sequence": { "sequence": "MRLSVRKVLLAAGCALALVLAVQLGQQVLECR", "length": 32, "header": "tr|D3YV96-1|D3YV96_MOUSE Computationally mapped isoform of Protein-tyrosine sulfotransferase 2 OS=Mus musculus OX=10090 GN=Tpst2 PE=4 SV=9 CANONICAL=O88856-1" }, "locus": { "chromosome": "5", "start_pos": 112455600, "end_pos": 112455505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000151947.3", "url": "https://www.ensembl.org/id/ENSMUST00000151947.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114592.3", "url": "https://www.ensembl.org/id/ENSMUSP00000114592.3" } ] } }, { "isoform_ac": "F7BM44-1", "url": "", "sequence": { "sequence": "XVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSK", "length": 63, "header": "tr|F7BM44-1|F7BM44_MOUSE Computationally mapped isoform of Protein-tyrosine sulfotransferase OS=Mus musculus OX=10090 GN=Tpst2 PE=1 SV=1 CANONICAL=O88856-1" }, "locus": { "chromosome": "5", "start_pos": 112456345, "end_pos": 112456157, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000140262.2", "url": "https://www.ensembl.org/id/ENSMUST00000140262.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000116816.2", "url": "https://www.ensembl.org/id/ENSMUSP00000116816.2" } ] } }, { "isoform_ac": "O88856-1", "url": "", "sequence": { "sequence": "MRLSVRKVLLAAGCALALVLAVQLGQQVLECRAVLGGTRNPRRMRPEQEELVMLGADHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS", "length": 376, "header": "sp|O88856-1|TPST2_MOUSE Isoform 1 of Protein-tyrosine sulfotransferase 2 OS=Mus musculus OX=10090 GN=Tpst2 PE=1 SV=1 CANONICAL=O88856-1" }, "locus": { "chromosome": "5", "start_pos": 112461146, "end_pos": 112455505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000071455", "url": "https://www.ensembl.org/id/ENSMUST00000071455" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000071399", "url": "https://www.ensembl.org/id/ENSMUSP00000071399" } ] } }, { "isoform_ac": "Q3TQN1-1", "url": "", "sequence": { "sequence": "MRRAPWLGLRPWLGMRLSVRKVLLAAGCALALVLAVQLGQQVLECRAVLGGTRNPRRMRPEQEELVMLGADHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS", "length": 390, "header": "tr|Q3TQN1-1|TPST2_MOUSE Computationally mapped isoform of Protein-tyrosine sulfotransferase 2 OS=Mus musculus OX=10090 GN=Tpst2 PE=1 SV=1 CANONICAL=O88856-1" }, "locus": { "chromosome": "5", "start_pos": 112461146, "end_pos": 112455505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000071455", "url": "https://www.ensembl.org/id/ENSMUST00000071455" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000071399", "url": "https://www.ensembl.org/id/ENSMUSP00000071399" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 342, "start_aa": "Asn", "end_pos": 342, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn342", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856#ptm_processing" }, { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "Cerebral cortical hypoplasia with abnormal morphology of pyramidal neuron in growth-retarded mouse (grt/grt).", "journal": "Acta neurobiologiae experimentalis", "date": "2014", "authors": "Horiuchi-Hirose M, Saito S, Sato C, Aoyama J, Kobayashi T, Sawada K", "evidence": [ { "database": "RefSeq", "id": "NP_001313519", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519" } ], "reference": [ { "type": "PubMed", "id": "25231844", "url": "https://glygen.org/publication/PubMed/25231844" } ] }, { "title": "TPST2-mediated receptor tyrosine sulfation enhances leukocidin cytotoxicity and S. aureus infection.", "journal": "Frontiers in immunology", "date": "2023", "authors": "He Jie, Yang Xianggui, Yang Kai, Xu Honglin, Chen Cheng, Wang Junxiong, Zeng Jun", "evidence": [ { "database": "RefSeq", "id": "NP_001313519", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001313519" } ], "reference": [ { "type": "PubMed", "id": "37671153", "url": "https://glygen.org/publication/PubMed/37671153" } ] }, { "title": "Molecular cloning and expression of human and mouse tyrosylprotein sulfotransferase-2 and a tyrosylprotein sulfotransferase homologue in Caenorhabditis elegans.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Ouyang YB, Moore KL", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "reference": [ { "type": "PubMed", "id": "9733778", "url": "https://glygen.org/publication/PubMed/9733778" } ] } ], "pathway": [ { "id": "mmu:22022", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22022", "resource": "KEGG Pathway" }, { "id": "R-MMU-156584", "name": "Cytosolic sulfonation of small molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156584", "resource": "Reactome", "description": "Cytosolic sulfonation of small molecules" }, { "id": "R-MMU-163841", "name": "Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-163841", "resource": "Reactome", "description": "Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation" } ], "orthologs": [ { "uniprot_canonical_ac": "O60704-1", "protein_name": "Protein-tyrosine sulfotransferase 2", "gene_name": "TPST2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS", "length": 377 }, "evidence": [ { "id": "45238007", "url": "http://www.informatics.jax.org/homology/45238007", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q5RJS8-1", "protein_name": "Protein-tyrosine sulfotransferase 2", "gene_name": "Tpst2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLSVRKVLLAVGCALALVLAVQLGQQVLECRAVLGGVRSPRRMQPEQEELVMLGADHVEYRYGKTMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS", "length": 376 }, "evidence": [ { "id": "45238007", "url": "http://www.informatics.jax.org/homology/45238007", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "peptidyl-tyrosine sulfation", "id": "GO:0006478", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006478", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" }, { "name": "fusion of sperm to egg plasma membrane involved in single fertilization", "id": "GO:0007342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007342", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" }, { "name": "prevention of polyspermy", "id": "GO:0060468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060468", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein-tyrosine sulfotransferase activity", "id": "GO:0008476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008476", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 342, "end_pos": 344, "annotation": "n_glycosylation_sequon" }, { "start_pos": 367, "end_pos": 369, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O88856", "url": "https://www.uniprot.org/uniprot/O88856" }, { "database": "PubMed", "id": "O60704", "url": "https://glygen.org/publication/PubMed/O60704" } ] } ], "interactions": [], "reactions": [ { "id": "16801", "name": "", "equation": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q3KR92-1", "Q5RJS8-1", "O60704-1", "O60507-1", "O70281-1", "O88856-1", "Q9VYB7-1" ], "evidence": [ { "id": "16801", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16801" } ] }, { "id": "R-MMU-8954262", "name": "TPST1,2 transfer SO4(2-) from PAPS to PODXL2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-MMU-8954248" ], "output_participant_list": [ "R-MMU-8954273" ], "enzyme_list": [ "O70281-1", "O88856-1" ], "evidence": [ { "id": "R-MMU-8954262", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8954262" } ] }, { "id": "R-MMU-9668023", "name": "TPST1,2 transfer SO4(2-) from PAPS to FVIII", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [ "R-MMU-9668037" ], "output_participant_list": [ "R-MMU-9668036" ], "enzyme_list": [ "O70281-1", "O88856-1" ], "evidence": [ { "id": "R-MMU-9668023", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9668023" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-8954248", "participant_name": "Podxl2 [Golgi lumen]", "crossref": [ { "id": "2442488", "database": "MGI", "url": "" }, { "id": "Q8CAE9", "database": "PRO", "url": "" }, { "id": "NP_795947.3", "database": "RefSeq", "url": "" }, { "id": "Q8CAE9", "database": "UniProt", "url": "" } ] }, { "participant_id": "R-MMU-8954273", "participant_name": "Podxl2 [Golgi lumen]", "crossref": [ { "id": "Q8CAE9", "database": "UniProt", "url": "" }, { "id": "2442488", "database": "MGI", "url": "" }, { "id": "NP_795947.3", "database": "RefSeq", "url": "" }, { "id": "Q8CAE9", "database": "PRO", "url": "" } ] }, { "participant_id": "R-MMU-9668036", "participant_name": "F8 [Golgi lumen]", "crossref": [ { "id": "Q06194", "database": "UniProt", "url": "" }, { "id": "88383", "database": "MGI", "url": "" }, { "id": "ENSMUSG00000031196", "database": "Ensembl", "url": "" }, { "id": "ENSG00000185010", "database": "OpenTargets", "url": "" }, { "id": "ENSMUST00000033539", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000033539", "database": "Ensembl", "url": "" }, { "id": "Q06194", "database": "PRO", "url": "" }, { "id": "NP_032003.2", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-9668037", "participant_name": "F8 [Golgi lumen]", "crossref": [ { "id": "Q06194", "database": "UniProt", "url": "" }, { "id": "88383", "database": "MGI", "url": "" }, { "id": "ENSMUST00000033539", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000031196", "database": "Ensembl", "url": "" }, { "id": "Q06194", "database": "PRO", "url": "" }, { "id": "NP_032003.2", "database": "RefSeq", "url": "" }, { "id": "ENSG00000185010", "database": "OpenTargets", "url": "" }, { "id": "ENSMUSP00000033539", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O60507", "gene_name": "TPST1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O60507", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60507" } ] } ] }, { "uniprot_ac": "O60704", "gene_name": "TPST2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O60704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60704" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O60704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60704" } ] } ] }, { "uniprot_ac": "O70281", "gene_name": "Tpst1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O70281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70281" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O70281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70281" } ] } ] }, { "uniprot_ac": "O88856", "gene_name": "Tpst2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "O88856", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88856" } ] } ] }, { "uniprot_ac": "Q3KR92", "gene_name": "Tpst1", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q3KR92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3KR92" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q3KR92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3KR92" } ] } ] }, { "uniprot_ac": "Q5RJS8", "gene_name": "Tpst2", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q5RJS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJS8" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q5RJS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJS8" } ] } ] }, { "uniprot_ac": "Q9VYB7", "gene_name": "Tpst", "activity": [ { "ec_number": "2.8.2.20", "activity": "3'-phosphoadenylyl sulfate + L-tyrosyl-[protein] = adenosine 3',5'-bisphosphate + H(+) + O-sulfo-L-tyrosine-[protein].", "evidence": [ { "id": "Q9VYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYB7" } ] }, { "ec_number": "2.8.2.20", "activity": "", "evidence": [ { "id": "Q9VYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYB7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }