{ "uniprot_canonical_ac": "O88816-1", "uniprot_ac": "O88816", "uniprot_id": "SNAT_MOUSE", "mass": { "chemical_mass": 23069.0, "monoisotopic_mass": 23069.0 }, "refseq": { "ac": "NP_033721", "name": "serotonin N-acetyltransferase", "summary": "The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" }, "gene_names": [ { "name": "Aanat", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O88816", "id": "O88816" }, { "name": "AA-NAT; Nat-2; Nat4; Snat", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721", "id": "NP_033721" }, { "name": "Aanat", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721", "id": "NP_033721" }, { "name": "Snat", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O88816", "id": "O88816" } ], "protein_names": [ { "name": "Serotonin N-acetyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O88816" }, { "name": "2.3.1.87", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88816" }, { "name": "AA-NAT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88816" }, { "name": "Aralkylamine N-acetyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88816" }, { "name": "Serotonin acetylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88816" }, { "name": "serotonin N-acetyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721", "id": "NP_033721" }, { "name": "serotonin acetylase; aralkylamine N-acetyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721", "id": "NP_033721" } ], "function": [ { "annotation": "Controls the night/day rhythm of melatonin production in the pineal gland. Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin.", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816#function" }, { "database": "UniProtKB", "id": "Q29495", "url": "https://www.uniprot.org/uniprot/Q29495#function" } ] }, { "annotation": "Report shows that the embryos synthesize melatonin by the enzyme Aanat which is located in the mitochondria.", "evidence": [ { "database": "RefSeq", "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" }, { "database": "PubMed", "id": "30343588", "url": "https://glygen.org/publication/PubMed/30343588" } ] }, { "annotation": "The Uterine Melatonergic Systems of AANAT and Melatonin Membrane Receptor 2 (MT2) Are Essential for Endometrial Receptivity and Early Implantation in Mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" }, { "database": "PubMed", "id": "37108290", "url": "https://glygen.org/publication/PubMed/37108290" } ] }, { "annotation": "The protein encoded by this gene belongs to the acetyltransferase superfamily. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for the function of the circadian clock that influences activity and sleep. This enzyme is regulated by cAMP-dependent phosphorylation that promotes its interaction with 14-3-3 proteins and thus protects the enzyme against proteasomal degradation. This gene may contribute to numerous genetic diseases such as delayed sleep phase syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" } ] } ], "disease": [ { "disease_id": "DOID:0050628", "recommended_name": { "id": "DOID:0050628", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050628", "name": "advanced sleep phase syndrome", "description": "A sleep disorder that involves an altered circadian rhythm resulting in falling asleep in early evening and awaking very early in the morning." }, "synonyms": [ { "id": "DOID:0050628", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050628", "name": "familial advanced sleep-phase syndrome", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome 1", "description": "Any advanced sleep phase syndrome in which the cause of the disease is a mutation in the PER2 gene." }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "FASPS1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "PER2 advanced sleep phase syndrome", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome caused by mutation in PER2", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome type 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome, familial, type 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "familial advanced sleep phase syndrome 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome, familial, 1", "description": "" }, { "id": "MIM:604348", "resource": "MIM", "url": "https://www.omim.org/entry/604348", "name": "Advanced sleep phase syndrome, familial, 1", "description": "Advanced sleep phase syndrome, familial, 1" } ], "evidence": [ { "id": "0050628", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050628" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Aanat", "url": "https://www.uniprot.org/uniprot/O88816", "locus": { "chromosome": "11", "start_pos": 116488506, "end_pos": 116477258, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020804", "url": "https://www.ensembl.org/id/ENSMUSG00000020804" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020804", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020804", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "11298", "url": "https://www.ncbi.nlm.nih.gov/gene/11298", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000182", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000182", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:11298", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11298", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1328365", "url": "http://www.informatics.jax.org/marker/MGI:1328365", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HFLNLCP", "url": "https://omabrowser.org/oma/group/HFLNLCP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1327238at2759", "url": "http://www.orthodb.org/?query=1327238at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10908", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10908", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10908:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10908:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00583", "url": "http://pfam.xfam.org/family/PF00583", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O88816", "url": "http://purl.obolibrary.org/obo/PR_O88816", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-209931", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-209931", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "20497", "url": "https://www.rhea-db.org/rhea/20497", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F2Z3V1", "url": "https://www.uniprot.org/uniprot/F2Z3V1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3V1-1", "url": "https://www.uniprot.org/uniprot/F2Z3V1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88816-1", "url": "https://www.uniprot.org/uniprot/O88816-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QUP1", "url": "https://www.uniprot.org/uniprot/Q9QUP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QUP1-1", "url": "https://www.uniprot.org/uniprot/Q9QUP1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLNINSLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREAFISVSGTCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLTQESLTLHRPGGRTAHLHVLAVHRTFRQQGKGSVLLWRYLHHLGSQPAVRRAVLMCEDALVPFYEKFGFQAVGPCAITVGSLTFTELQCSLRCHAFLRRNSGC", "length": 205, "header": "sp|O88816-1|SNAT_MOUSE Isoform 1 of Serotonin N-acetyltransferase OS=Mus musculus OX=10090 GN=Aanat PE=2 SV=1 CANONICAL=O88816-1" }, "isoforms": [ { "isoform_ac": "F2Z3V1-1", "url": "", "sequence": { "sequence": "MLNINSLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREARAGSPE", "length": 59, "header": "tr|F2Z3V1-1|SNAT_MOUSE Computationally mapped isoform of Serotonin N-acetyltransferase OS=Mus musculus OX=10090 GN=Aanat PE=2 SV=1 CANONICAL=O88816-1" }, "locus": { "chromosome": "11", "start_pos": 116486882, "end_pos": 116486463, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000123507.2", "url": "https://www.ensembl.org/id/ENSMUST00000123507.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115999.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115999.2" } ] } }, { "isoform_ac": "O88816-1", "url": "", "sequence": { "sequence": "MLNINSLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREAFISVSGTCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLTQESLTLHRPGGRTAHLHVLAVHRTFRQQGKGSVLLWRYLHHLGSQPAVRRAVLMCEDALVPFYEKFGFQAVGPCAITVGSLTFTELQCSLRCHAFLRRNSGC", "length": 205, "header": "sp|O88816-1|SNAT_MOUSE Isoform 1 of Serotonin N-acetyltransferase OS=Mus musculus OX=10090 GN=Aanat PE=2 SV=1 CANONICAL=O88816-1" }, "locus": { "chromosome": "11", "start_pos": 116487917, "end_pos": 116486463, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000153476", "url": "https://www.ensembl.org/id/ENSMUST00000153476" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122895", "url": "https://www.ensembl.org/id/ENSMUSP00000122895" } ] } }, { "isoform_ac": "Q9QUP1-1", "url": "", "sequence": { "sequence": "MLNINSLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREAFISVSGTCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLTQS", "length": 105, "header": "tr|Q9QUP1-1|SNAT_MOUSE Computationally mapped isoform of Serotonin N-acetyltransferase OS=Mus musculus OX=10090 GN=Aanat PE=2 SV=1 CANONICAL=O88816-1" }, "locus": { "chromosome": "11", "start_pos": 116487379, "end_pos": 116486463, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000021160.10", "url": "https://www.ensembl.org/id/ENSMUST00000021160.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000021160.4", "url": "https://www.ensembl.org/id/ENSMUSP00000021160.4" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "site_lbl": "Ser203" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "site_lbl": "Thr29" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Genetic variation of melatonin productivity in laboratory mice under domestication.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2010", "authors": "Kasahara T, Abe K, Mekada K, Yoshiki A, Kato T", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "reference": [ { "type": "PubMed", "id": "20308563", "url": "https://glygen.org/publication/PubMed/20308563" } ] }, { "title": "Aanat Knockdown and Melatonin Supplementation in Embryo Development: Involvement of Mitochondrial Function and DNA Methylation.", "journal": "Antioxidants & redox signaling", "date": "2019", "authors": "Yang M, Tao J, Wu H, Guan S, Liu L, Zhang L, Deng S, He C, Ji P, Liu J, Liu G", "evidence": [ { "database": "RefSeq", "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" } ], "reference": [ { "type": "PubMed", "id": "30343588", "url": "https://glygen.org/publication/PubMed/30343588" } ] }, { "title": "The Uterine Melatonergic Systems of AANAT and Melatonin Membrane Receptor 2 (MT2) Are Essential for Endometrial Receptivity and Early Implantation in Mice.", "journal": "International journal of molecular sciences", "date": "2023-04-12", "authors": "Ma Xiao, Wang Jing, Wang Likai, Yan Laiqing, Liu Yunjie, Ma Wenkui, Ji Pengyun, Zhang Lu, Liu Guoshi", "evidence": [ { "database": "RefSeq", "id": "NP_033721", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_033721" } ], "reference": [ { "type": "PubMed", "id": "37108290", "url": "https://glygen.org/publication/PubMed/37108290" } ] }, { "title": "Molecular cloning of serotonin N-acetyltransferase gene from the mouse and its daily expression in the retina.", "journal": "Neurosci. Lett.", "date": "1998", "authors": "Sakamoto K., Ishida N.", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "reference": [ { "type": "PubMed", "id": "9708862", "url": "https://glygen.org/publication/PubMed/9708862" } ] }, { "title": "Natural melatonin 'knockdown' in C57BL/6J mice: rare mechanism truncates serotonin N-acetyltransferase.", "journal": "Brain Res. Mol. Brain Res.", "date": "1998", "authors": "Popescu N.C., Gastel J.A., Klein D.C., Zimonjic D.B., Rodriguez I.R., Roseboom P.H., Namboodiri M.A.A.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUP1", "url": "https://www.uniprot.org/uniprot/Q9QUP1" }, { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "reference": [ { "type": "PubMed", "id": "9838107", "url": "https://glygen.org/publication/PubMed/9838107" } ] } ], "pathway": [ { "id": "mmu:11298", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:11298", "resource": "KEGG Pathway" }, { "id": "R-MMU-209931", "name": "Serotonin and melatonin biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-209931", "resource": "Reactome", "description": "Serotonin and melatonin biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q16613-1", "protein_name": "Serotonin N-acetyltransferase", "gene_name": "AANAT", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPFLRRNSGC", "length": 207 }, "evidence": [ { "id": "45224523", "url": "http://www.informatics.jax.org/homology/45224523", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q64666-1", "protein_name": "Serotonin N-acetyltransferase", "gene_name": "Aanat", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLSIHPLKPEALHLPLGTSEFLGCQRRHTLPASEFRCLTPEDATSAFEIEREAFISVSGTCPLHLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLTQESLTLHRPGGRTAHLHVLAVHRTFRQQGKGSVLLWRYLHHLGSQPAVRRAVLMCENALVPFYEKFGFQAMGPCAITMGSLTFTELQCSLRCHTFLRRNSGC", "length": 205 }, "evidence": [ { "id": "45224523", "url": "http://www.informatics.jax.org/homology/45224523", "database": "MGI" }, { "id": "O88816", "url": "https://omabrowser.org/oma/group/O88816/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "aralkylamine N-acetyltransferase activity", "id": "GO:0004059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004059", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "14-3-3 protein binding", "id": "GO:0071889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071889", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "arylamine N-acetyltransferase activity", "id": "GO:0004060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004060", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "response to zinc ion", "id": "GO:0010043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010043", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to calcium ion", "id": "GO:0051592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051592", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "cellular response to cAMP", "id": "GO:0071320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071320", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to cytokine", "id": "GO:0034097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034097", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to copper ion", "id": "GO:0046688", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046688", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "melatonin biosynthetic process", "id": "GO:0030187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030187", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "response to prostaglandin E", "id": "GO:0034695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034695", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "photoperiodism", "id": "GO:0009648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009648", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" }, { "name": "N-terminal protein amino acid acetylation", "id": "GO:0006474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006474", "evidence": [ { "database": "UniProtKB", "id": "O88816", "url": "https://www.uniprot.org/uniprot/O88816" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20497", "name": "", "equation": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64666-1", "Q16613-1", "O88816-1", "Q94521-1", "Q9VMG0-1" ], "evidence": [ { "id": "20497", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20497" } ] }, { "id": "R-MMU-209792", "name": "N-acetylation of serotonin", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O88816-1" ], "evidence": [ { "id": "R-MMU-209792", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-209792" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O88816", "gene_name": "Aanat", "activity": [ { "ec_number": "2.3.1.87", "activity": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+).", "evidence": [ { "id": "O88816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88816" } ] }, { "ec_number": "2.3.1.87", "activity": "", "evidence": [ { "id": "O88816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88816" } ] } ] }, { "uniprot_ac": "Q16613", "gene_name": "AANAT", "activity": [ { "ec_number": "2.3.1.87", "activity": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+).", "evidence": [ { "id": "Q16613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16613" } ] }, { "ec_number": "2.3.1.87", "activity": "", "evidence": [ { "id": "Q16613", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16613" } ] } ] }, { "uniprot_ac": "Q64666", "gene_name": "Aanat", "activity": [ { "ec_number": "2.3.1.87", "activity": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+).", "evidence": [ { "id": "Q64666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64666" } ] }, { "ec_number": "2.3.1.87", "activity": "", "evidence": [ { "id": "Q64666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64666" } ] } ] }, { "uniprot_ac": "Q94521", "gene_name": "speck", "activity": [ { "ec_number": "2.3.1.87", "activity": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+).", "evidence": [ { "id": "Q94521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94521" } ] }, { "ec_number": "2.3.1.87", "activity": "", "evidence": [ { "id": "Q94521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94521" } ] } ] }, { "uniprot_ac": "Q9VMG0", "gene_name": "AANATL2", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q9VMG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMG0" } ] }, { "ec_number": "2.3.1.87", "activity": "a 2-arylethylamine + acetyl-CoA = an N-acetyl-2-arylethylamine + CoA + H(+).", "evidence": [ { "id": "Q9VMG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMG0" } ] }, { "ec_number": "2.3.1.87", "activity": "", "evidence": [ { "id": "Q9VMG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMG0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }