{ "uniprot_canonical_ac": "O88498-1", "uniprot_ac": "O88498", "uniprot_id": "B2L11_RAT", "mass": { "chemical_mass": 22056.0, "monoisotopic_mass": 22056.0 }, "refseq": {}, "gene_names": [ { "name": "Bcl2l11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O88498", "id": "O88498" }, { "name": "Bim", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O88498", "id": "O88498" }, { "name": "Bod", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O88498", "id": "O88498" } ], "protein_names": [ { "name": "Bcl-2-like protein 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O88498" }, { "name": "Bcl-2-related ovarian death protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88498" }, { "name": "Bcl2-L-11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88498" }, { "name": "Bcl2-interacting mediator of cell death", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88498" } ], "function": [ { "annotation": "Induces apoptosis and anoikis.", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498#function" }, { "database": "PubMed", "id": "9731710", "url": "https://glygen.org/publication/PubMed/9731710" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "common_name": "Rat" } ], "gene": [ { "name": "Bcl2l11", "url": "https://www.uniprot.org/uniprot/O88498", "locus": { "chromosome": "3", "start_pos": 115404068, "end_pos": 115366646, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000016551", "url": "https://www.ensembl.org/id/ENSRNOG00000016551" } ] } } ], "crossref": [ { "id": "ENSRNOG00000016551", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000016551", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "64547", "url": "https://www.ncbi.nlm.nih.gov/gene/64547", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O88498", "url": "https://www.ebi.ac.uk/intact/interactors/id:O88498*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR014771", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014771", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015040", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015040", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017288", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017288", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:64547", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64547", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "EIWIARE", "url": "https://omabrowser.org/oma/group/EIWIARE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4327858at2759", "url": "http://www.orthodb.org/?query=4327858at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12044", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12044", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12044:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12044:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06773", "url": "http://pfam.xfam.org/family/PF06773", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08945", "url": "http://pfam.xfam.org/family/PF08945", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O88498", "url": "http://purl.obolibrary.org/obo/PR_O88498", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-111446", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111446", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111453", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_072134", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_072134", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "628774", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=628774", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZK47", "url": "https://www.uniprot.org/uniprot/A0A8I5ZK47", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZK47-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZK47-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZPX5", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPX5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZPX5-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPX5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QCL5", "url": "https://www.uniprot.org/uniprot/A0A8L2QCL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QCL5-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QCL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QJ59", "url": "https://www.uniprot.org/uniprot/A0A8L2QJ59", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QJ59-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QJ59-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88498-1", "url": "https://www.uniprot.org/uniprot/O88498-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88498-2", "url": "https://www.uniprot.org/uniprot/O88498-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88498-3", "url": "https://www.uniprot.org/uniprot/O88498-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88498-4", "url": "https://www.uniprot.org/uniprot/O88498-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 196, "header": "sp|O88498-1|B2L11_RAT Isoform 1 of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZK47-1", "url": "", "sequence": { "sequence": "MIPAVAGAARARGAARETLGSPAERGGGRTGRRGALEPRTRLCFPCLLGGYVQGSSDRHNTLRSEGKGRTKKDQMAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 214, "header": "tr|A0A8I5ZK47-1|A0A8I5ZK47_RAT Computationally mapped isoform of BCL2 like 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=4 SV=1 CANONICAL=O88498-1" }, "locus": { "chromosome": "3", "start_pos": 115399827, "end_pos": 115368406, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108485.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108485.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000076665.1", "url": "https://www.ensembl.org/id/ENSRNOP00000076665.1" } ] } }, { "isoform_ac": "A0A8I5ZPX5-1", "url": "", "sequence": { "sequence": "LSQPARASGLGAVGGGTYLPACPGRTERGAEPAVIGRRSGGSVRAEWLGQAAFTSLPAGTGSTACWSSAVLAAAAVVVAVTGFLQPLRELCSTWIHTTSAAPAATASAPFPWPSSTQCLTLILGLRNARKKDQMAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 243, "header": "tr|A0A8I5ZPX5-1|A0A8I5ZPX5_RAT Computationally mapped isoform of BCL2 like 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=4 SV=1 CANONICAL=O88498-1" }, "locus": { "chromosome": "3", "start_pos": 115399827, "end_pos": 115366647, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000113569.1", "url": "https://www.ensembl.org/id/ENSRNOT00000113569.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000080342.1", "url": "https://www.ensembl.org/id/ENSRNOP00000080342.1" } ] } }, { "isoform_ac": "A0A8L2QCL5-1", "url": "", "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMAQLENLNQVAENIHGDACS", "length": 90, "header": "tr|A0A8L2QCL5-1|B2L11_RAT Computationally mapped isoform of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": { "chromosome": "3", "start_pos": 115370546, "end_pos": 115369443, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000022596.7", "url": "https://www.ensembl.org/id/ENSRNOT00000022596.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000022596.4", "url": "https://www.ensembl.org/id/ENSRNOP00000022596.4" } ] } }, { "isoform_ac": "A0A8L2QJ59-1", "url": "", "sequence": { "sequence": "MIPAVAGAARARGAARETLGSPAERGGGRTGRRGALEPRTRLCFPCLLGGYVQGSSDRHNTLRSEGKGRTKKDQMAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 270, "header": "tr|A0A8L2QJ59-1|B2L11_RAT Computationally mapped isoform of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": { "chromosome": "3", "start_pos": 115399827, "end_pos": 115368406, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000051069.6", "url": "https://www.ensembl.org/id/ENSRNOT00000051069.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000039006.5", "url": "https://www.ensembl.org/id/ENSRNOP00000039006.5" } ] } }, { "isoform_ac": "O88498-1", "url": "", "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 196, "header": "sp|O88498-1|B2L11_RAT Isoform 1 of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": {} }, { "isoform_ac": "O88498-2", "url": "", "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 140, "header": "sp|O88498-2|B2L11_RAT Isoform 2 of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": {} }, { "isoform_ac": "O88498-3", "url": "", "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 110, "header": "sp|O88498-3|B2L11_RAT Isoform 3 of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": {} }, { "isoform_ac": "O88498-4", "url": "", "sequence": { "sequence": "MSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 93, "header": "sp|O88498-4|B2L11_RAT Isoform 4 of Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1 CANONICAL=O88498-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O88498", "url": "http://phospho.elm.eu.org/byAccession/O88498.html" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" }, { "database": "PubMed", "id": "12388545", "url": "https://glygen.org/publication/PubMed/12388545" } ], "site_lbl": "Ser109" }, { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O88498", "url": "http://phospho.elm.eu.org/byAccession/O88498.html" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" }, { "database": "PubMed", "id": "12388545", "url": "https://glygen.org/publication/PubMed/12388545" } ], "site_lbl": "Thr110" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "P70618-1", "kinase_gene_name": "Mapk14", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ], "site_lbl": "Ser65" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" }, { "database": "PubMed", "id": "21984578", "url": "https://glygen.org/publication/PubMed/21984578" }, { "database": "PubMed", "id": "27511131", "url": "https://glygen.org/publication/PubMed/27511131" }, { "database": "PubMed", "id": "29048431", "url": "https://glygen.org/publication/PubMed/29048431" } ], "site_lbl": "Ser65" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "site_lbl": "Ser73" }, { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "site_lbl": "Ser83" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "site_lbl": "Ser90" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Nerve growth factor (NGF) down-regulates the Bcl-2 homology 3 (BH3) domain-only protein Bim and suppresses its proapoptotic activity by phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Biswas SC, Greene LA", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "12388545", "url": "https://glygen.org/publication/PubMed/12388545" } ] }, { "title": "BimEL is an important determinant for induction of anoikis sensitivity by mitogen-activated protein/extracellular signal-regulated kinase kinase inhibitors.", "journal": "Molecular cancer therapeutics", "date": "2004", "authors": "Fukazawa H, Noguchi K, Masumi A, Murakami Y, Uehara Y", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ] }, { "title": "Identification of a novel Bcl-2-interacting mediator of cell death (Bim) E3 ligase, tripartite motif-containing protein 2 (TRIM2), and its role in rapid ischemic tolerance-induced neuroprotection.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Thompson S, Pearson AN, Ashley MD, Jessick V, Murphy BM, Gafken P, Henshall DC, Morris KT, Simon RP, Meller R", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "reference": [ { "type": "PubMed", "id": "21478148", "url": "https://glygen.org/publication/PubMed/21478148" } ] }, { "title": "PTPN2, a candidate gene for type 1 diabetes, modulates pancreatic \u03b2-cell apoptosis via regulation of the BH3-only protein Bim.", "journal": "Diabetes", "date": "2011-12", "authors": "Santin Izortze, Moore Fabrice, Colli Maikel L, Gurzov Esteban N, Marselli Lorella, Marchetti Piero, Eizirik Decio L", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "21984578", "url": "https://glygen.org/publication/PubMed/21984578" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Insulin-like growth factor 1 rescues R28 retinal neurons from apoptotic death through ERK-mediated BimEL phosphorylation independent of Akt.", "journal": "Experimental eye research", "date": "2016-10", "authors": "Kong Dejuan, Gong Lijie, Arnold Edith, Shanmugam Sumathi, Fort Patrice E, Gardner Thomas W, Abcouwer Steven F", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "27511131", "url": "https://glygen.org/publication/PubMed/27511131" } ] }, { "title": "HSPB1 facilitates ERK-mediated phosphorylation and degradation of BIM to attenuate endoplasmic reticulum stress-induced apoptosis.", "journal": "Cell death & disease", "date": "2017", "authors": "Kennedy D, Mnich K, Oommen D, Chakravarthy R, Almeida-Souza L, Krols M, Saveljeva S, Doyle K, Gupta S, Timmerman V, Janssens S, Gorman AM, Samali A", "evidence": [ { "database": "iPTMnet", "id": "O88498", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O88498" } ], "reference": [ { "type": "PubMed", "id": "29048431", "url": "https://glygen.org/publication/PubMed/29048431" } ] }, { "title": "BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members.", "journal": "Mol. Endocrinol.", "date": "1998", "authors": "Hsu SY, Lin P, Hsueh AJ", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "reference": [ { "type": "PubMed", "id": "9731710", "url": "https://glygen.org/publication/PubMed/9731710" } ] } ], "pathway": [ { "id": "rno:64547", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:64547", "resource": "KEGG Pathway" }, { "id": "R-RNO-111446", "name": "Activation of BIM and translocation to mitochondria", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111446", "resource": "Reactome", "description": "Activation of BIM and translocation to mitochondria" }, { "id": "R-RNO-111453", "name": "BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-111453", "resource": "Reactome", "description": "BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members" }, { "id": "R-RNO-193648", "name": "NRAGE signals death through JNK", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-193648", "resource": "Reactome", "description": "NRAGE signals death through JNK" } ], "orthologs": [ { "uniprot_canonical_ac": "O43521-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "BCL2L11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 198 }, "evidence": [ { "id": "45229740", "url": "http://www.informatics.jax.org/homology/45229740", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "O54918-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "Bcl2l11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 196 }, "evidence": [ { "id": "45229740", "url": "http://www.informatics.jax.org/homology/45229740", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 44, "go_terms": [ { "name": "lymphocyte homeostasis", "id": "GO:0002260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002260", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "cellular response to nerve growth factor stimulus", "id": "GO:1990090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990090", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "male gonad development", "id": "GO:0008584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:0008630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "post-embryonic development", "id": "GO:0009791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "spleen development", "id": "GO:0048536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048536", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "thymus development", "id": "GO:0048538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048538", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of neuron apoptotic process", "id": "GO:0043525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "T cell homeostasis", "id": "GO:0043029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043029", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of release of cytochrome c from mitochondria", "id": "GO:0090200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090200", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "cellular response to estradiol stimulus", "id": "GO:0071392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071392", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "response to endoplasmic reticulum stress", "id": "GO:0034976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034976", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "B cell homeostasis", "id": "GO:0001782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001782", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "myeloid cell homeostasis", "id": "GO:0002262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002262", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "thymocyte apoptotic process", "id": "GO:0070242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070242", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial membrane permeability involved in apoptotic process", "id": "GO:1902110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902110", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "apoptotic process involved in embryonic digit morphogenesis", "id": "GO:1902263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902263", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "tube formation", "id": "GO:0035148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035148", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "ear development", "id": "GO:0043583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043583", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "regulation of organ growth", "id": "GO:0046620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046620", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "developmental pigmentation", "id": "GO:0048066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048066", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "regulation of developmental pigmentation", "id": "GO:0048070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048070", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "post-embryonic animal organ morphogenesis", "id": "GO:0048563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048563", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of fibroblast apoptotic process", "id": "GO:2000271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000271", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "leukocyte homeostasis", "id": "GO:0001776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001776", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "T cell apoptotic process", "id": "GO:0070231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070231", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of T cell apoptotic process", "id": "GO:0070234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070234", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of autophagy in response to ER overload", "id": "GO:0034263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034263", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "positive regulation of lymphocyte apoptotic process", "id": "GO:0070230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070230", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "meiosis I", "id": "GO:0007127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007127", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "lymphocyte apoptotic process", "id": "GO:0070227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070227", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "dynein complex binding", "id": "GO:0070840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070840", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" }, { "name": "Bcl-2 family protein complex", "id": "GO:0097136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097136", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 158, "end_pos": 160, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation at Ser-65 by MAPK1/MAPK3 leads interaction with TRIM2 and ubiquitination, followed by proteasomal degradation. Deubiquitination catalyzed by USP27X stabilizes the protein.", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "PubMed", "id": "O54918", "url": "https://glygen.org/publication/PubMed/O54918" } ] }, { "annotation": "Ubiquitination by TRIM2 following phosphorylation by MAPK1/MAPK3 leads to proteasomal degradation (PubMed:21478148). Conversely, deubiquitination catalyzed by USP27X stabilizes the protein (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O88498", "url": "https://www.uniprot.org/uniprot/O88498" }, { "database": "PubMed", "id": "O54918", "url": "https://glygen.org/publication/PubMed/O54918" }, { "database": "PubMed", "id": "21478148", "url": "https://glygen.org/publication/PubMed/21478148" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }