{ "uniprot_canonical_ac": "O88272-1", "uniprot_ac": "O88272", "uniprot_id": "MMP23_RAT", "mass": { "chemical_mass": 44618.0, "monoisotopic_mass": 44618.0 }, "refseq": { "ac": "NP_446058", "name": "matrix metalloproteinase-23", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446058" }, "gene_names": [ { "name": "Mmp23", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O88272", "id": "O88272" }, { "name": "Mifr", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O88272", "id": "O88272" }, { "name": "Mmp23", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446058", "id": "NP_446058" } ], "protein_names": [ { "name": "Matrix metalloproteinase-23", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O88272" }, { "name": "3.4.24.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88272" }, { "name": "MIFR; MMP-23; metaloprotease in the female reproductive tract; Matrix metalloproteinase 23; metalloprotease in the female reproductive tract", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446058", "id": "NP_446058" }, { "name": "MIFR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88272" }, { "name": "MMP-23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88272" }, { "name": "matrix metalloproteinase-23", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446058", "id": "NP_446058" }, { "name": "metalloprotease in the female reproductive tract", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O88272" } ], "function": [ { "annotation": "Protease. May regulate the surface expression of some potassium channels by retaining them in the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272#function" }, { "database": "PubMed", "id": "19965868", "url": "https://glygen.org/publication/PubMed/19965868" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mmp23", "url": "https://www.uniprot.org/uniprot/O88272", "locus": { "chromosome": "5", "start_pos": 166239644, "end_pos": 166242433, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000017477", "url": "https://www.ensembl.org/id/ENSRNOG00000017477" } ] } } ], "crossref": [ { "id": "ENSRNOG00000017477", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000017477", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00096", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd04278", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04278", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "94339", "url": "https://www.ncbi.nlm.nih.gov/gene/94339", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001818", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001818", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003582", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003582", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006026", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006026", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021190", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021190", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033739", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033739", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:94339", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:94339", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HLHHCFD", "url": "https://omabrowser.org/oma/group/HLHHCFD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3012491at2759", "url": "http://www.orthodb.org/?query=3012491at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10201", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10201:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2K72", "url": "https://www.rcsb.org/structure/2K72", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00413", "url": "http://pfam.xfam.org/family/PF00413", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01549", "url": "http://pfam.xfam.org/family/PF01549", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O88272", "url": "http://purl.obolibrary.org/obo/PR_O88272", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_446058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446058", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620201", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620201", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O88272-1", "url": "https://www.uniprot.org/uniprot/O88272-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGWRACLRPEASGAVQGRWLGAVLSGLCLLSALAFLEWLGSPTETAWNAAQGNVDAPDVGGSTPQVPSLLSMLVTRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCTSWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRFVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEARLSIIANAVNEGTYTCVVRHRQRVLTTYSWRVRVRS", "length": 391, "header": "sp|O88272-1|MMP23_RAT Isoform 1 of Matrix metalloproteinase-23 OS=Rattus norvegicus OX=10116 GN=Mmp23 PE=1 SV=1 CANONICAL=O88272-1" }, "isoforms": [ { "isoform_ac": "O88272-1", "url": "", "sequence": { "sequence": "MGWRACLRPEASGAVQGRWLGAVLSGLCLLSALAFLEWLGSPTETAWNAAQGNVDAPDVGGSTPQVPSLLSMLVTRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCTSWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRFVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEARLSIIANAVNEGTYTCVVRHRQRVLTTYSWRVRVRS", "length": 391, "header": "sp|O88272-1|MMP23_RAT Isoform 1 of Matrix metalloproteinase-23 OS=Rattus norvegicus OX=10116 GN=Mmp23 PE=1 SV=1 CANONICAL=O88272-1" }, "locus": { "chromosome": "5", "start_pos": 166242258, "end_pos": 166239699, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000066880", "url": "https://www.ensembl.org/id/ENSRNOT00000066880" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000061528", "url": "https://www.ensembl.org/id/ENSRNOP00000061528" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 149, "start_aa": "Asn", "end_pos": 149, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn149", "evidence": [ { "id": "O88272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88272#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "O88272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88272#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "O88272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88272#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "O88272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88272#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Cloning and characterization of a rat ortholog of MMP-23 (matrix metalloproteinase-23), a unique type of membrane-anchored matrix metalloproteinase and conditioned switching of its expression during the ovarian follicular development.", "journal": "Mol. Endocrinol.", "date": "2001", "authors": "Ohnishi J, Ohnishi E, Jin M, Hirano W, Nakane D, Matsui H, Kimura A, Sawa H, Nakayama K, Shibuya H, Nagashima K, Takahashi T", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "reference": [ { "type": "PubMed", "id": "11328856", "url": "https://glygen.org/publication/PubMed/11328856" } ] }, { "title": "Potassium channel modulation by a toxin domain in matrix metalloprotease 23.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Norton R.S., Calabresi P., Nugent D., Chandy K.G., Pennington M.W., Feng Z.P., Chi V., Crossley G., Khaytin I., Khoo K.K., Pham C., Rangaraju S.", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "reference": [ { "type": "PubMed", "id": "19965868", "url": "https://glygen.org/publication/PubMed/19965868" } ] } ], "pathway": [ { "id": "rno:94339", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:94339", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O75900-1", "protein_name": "Matrix metalloproteinase-23", "gene_name": "MMP23B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG", "length": 390 }, "evidence": [ { "id": "45233627", "url": "http://www.informatics.jax.org/homology/45233627", "database": "MGI" }, { "id": "O88272", "url": "https://omabrowser.org/oma/group/O88272/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "O88676-1", "protein_name": "Matrix metalloproteinase-23", "gene_name": "Mmp23", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGCRACLRPEASGAVQGRWLGAALSGLCLLSALALLEWLGAPTETAWRAAQGNVDAPNVGSSTAQVPRLLTMSVTRRRRYTLTPARLRWDHFNLTYRVLSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAQLSIIANAVNEGTYTCVVRRHQRVLSTYSWRVRVRN", "length": 391 }, "evidence": [ { "id": "45233627", "url": "http://www.informatics.jax.org/homology/45233627", "database": "MGI" }, { "id": "O88272", "url": "https://omabrowser.org/oma/group/O88272/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metalloendopeptidase activity", "id": "GO:0004222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004222", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "collagen catabolic process", "id": "GO:0030574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030574", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" }, { "name": "reproduction", "id": "GO:0000003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000003", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 149, "end_pos": 151, "annotation": "n_glycosylation_sequon" }, { "start_pos": 233, "end_pos": 235, "annotation": "n_glycosylation_sequon" }, { "start_pos": 317, "end_pos": 319, "annotation": "n_glycosylation_sequon" }, { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O88272", "url": "https://www.uniprot.org/uniprot/O88272" }, { "database": "PubMed", "id": "11328856", "url": "https://glygen.org/publication/PubMed/11328856" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }