{ "uniprot_canonical_ac": "O70435-1", "uniprot_ac": "O70435", "uniprot_id": "PSA3_MOUSE", "mass": { "chemical_mass": 28405.0, "monoisotopic_mass": 28405.0 }, "refseq": { "ac": "NP_001297524", "name": "proteasome subunit alpha type-3 isoform b", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297524" }, "gene_names": [ { "name": "Psma3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O70435", "id": "O70435" }, { "name": "Lmpc8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314", "id": "NP_035314" }, { "name": "Psma3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314", "id": "NP_035314" } ], "protein_names": [ { "name": "Proteasome subunit alpha type-3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O70435" }, { "name": "Macropain subunit C8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70435" }, { "name": "Multicatalytic endopeptidase complex subunit C8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70435" }, { "name": "Proteasome component C8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70435" }, { "name": "Proteasome subunit K", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70435" }, { "name": "proteasome subunit alpha type-3 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314", "id": "NP_035314" }, { "name": "proteasome subunit alpha type-3 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297524", "id": "NP_001297524" }, { "name": "proteasome subunit alpha type-3; macropain subunit C8; proteasome (prosome, macropain) subunit, alpha type 3; proteasome subunit K; proteasome component C8; multicatalytic endopeptidase complex subunit C8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297524", "id": "NP_001297524" } ], "function": [ { "annotation": "Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435#function" }, { "database": "PubMed", "id": "22341445", "url": "https://glygen.org/publication/PubMed/22341445" }, { "database": "PubMed", "id": "16581775", "url": "https://glygen.org/publication/PubMed/16581775" } ] }, { "annotation": "Protein interaction between Ambn and Psma3 can facilitate redistribution of ameloblastin domains within forming enamel.", "evidence": [ { "database": "RefSeq", "id": "NP_035314", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314" }, { "database": "PubMed", "id": "26070558", "url": "https://glygen.org/publication/PubMed/26070558" }, { "database": "RefSeq", "id": "NP_001297524", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297524" } ] } ], "disease": [ { "disease_id": "DOID:1289", "recommended_name": { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "neurodegenerative disease", "description": "A central nervous system disease that results in the progressive deterioration of function or structure of neurons." }, "synonyms": [ { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "degenerative disease", "description": "" } ], "evidence": [ { "id": "1289", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1289" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Psma3", "url": "https://www.uniprot.org/uniprot/O70435", "locus": { "chromosome": "12", "start_pos": 71043121, "end_pos": 71021395, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000060073", "url": "https://www.ensembl.org/id/ENSMUSG00000060073" } ] } } ], "crossref": [ { "id": "ENSMUSG00000060073", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000060073", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03751", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03751", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "19167", "url": "https://www.ncbi.nlm.nih.gov/gene/19167", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O70435", "url": "https://www.ebi.ac.uk/intact/interactors/id:O70435*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000426", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000426", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023332", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023332", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:19167", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:19167", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "104883", "url": "http://www.informatics.jax.org/marker/MGI:104883", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SMYMHAY", "url": "https://omabrowser.org/oma/group/SMYMHAY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "166567at2759", "url": "http://www.orthodb.org/?query=166567at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11599", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11599", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11599:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11599:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3UNB", "url": "https://www.rcsb.org/structure/3UNB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UNE", "url": "https://www.rcsb.org/structure/3UNE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UNF", "url": "https://www.rcsb.org/structure/3UNF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UNH", "url": "https://www.rcsb.org/structure/3UNH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00227", "url": "http://pfam.xfam.org/family/PF00227", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10584", "url": "http://pfam.xfam.org/family/PF10584", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O70435", "url": "http://purl.obolibrary.org/obo/PR_O70435", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1234176", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1236978", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174184", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195253", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-202424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2871837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-349425", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-349425", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-350562", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-450408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4608870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641258", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358346", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5607761", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5607764", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5607764", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610780", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610785", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5632684", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5658442", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5668541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5676590", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5676590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68867", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68949", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69481", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69601", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8852276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8854050", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8939236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8939902", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8939902", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8941858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8948751", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9020702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9755511", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9762114", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_035314", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E0CX62", "url": "https://www.uniprot.org/uniprot/E0CX62", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CX62-1", "url": "https://www.uniprot.org/uniprot/E0CX62-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CYL6", "url": "https://www.uniprot.org/uniprot/E0CYL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CYL6-1", "url": "https://www.uniprot.org/uniprot/E0CYL6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CZ34", "url": "https://www.uniprot.org/uniprot/E0CZ34", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CZ34-1", "url": "https://www.uniprot.org/uniprot/E0CZ34-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7BWF9", "url": "https://www.uniprot.org/uniprot/F7BWF9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7BWF9-1", "url": "https://www.uniprot.org/uniprot/F7BWF9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WH02", "url": "https://www.uniprot.org/uniprot/F8WH02", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WH02-1", "url": "https://www.uniprot.org/uniprot/F8WH02-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70435-1", "url": "https://www.uniprot.org/uniprot/O70435-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM", "length": 255, "header": "sp|O70435-1|PSA3_MOUSE Isoform 1 of Proteasome subunit alpha type-3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=3 CANONICAL=O70435-1" }, "isoforms": [ { "isoform_ac": "E0CX62-1", "url": "", "sequence": { "sequence": "MAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM", "length": 180, "header": "tr|E0CX62-1|E0CX62_MOUSE Computationally mapped isoform of Proteasome subunit alpha 3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=2 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71041166, "end_pos": 71030214, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000160864.8", "url": "https://www.ensembl.org/id/ENSMUST00000160864.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124894.3", "url": "https://www.ensembl.org/id/ENSMUSP00000124894.3" } ] } }, { "isoform_ac": "E0CYL6-1", "url": "", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSRVTGAVRLAKPGRLQRQR", "length": 52, "header": "tr|E0CYL6-1|PSA3_MOUSE Computationally mapped isoform of Proteasome subunit alpha type-3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=1 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71035249, "end_pos": 71021521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000162851.8", "url": "https://www.ensembl.org/id/ENSMUST00000162851.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124082.2", "url": "https://www.ensembl.org/id/ENSMUSP00000124082.2" } ] } }, { "isoform_ac": "E0CZ34-1", "url": "", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSR", "length": 35, "header": "tr|E0CZ34-1|E0CZ34_MOUSE Computationally mapped isoform of Proteasome subunit alpha 3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=1 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71025590, "end_pos": 71021521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000162626.8", "url": "https://www.ensembl.org/id/ENSMUST00000162626.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125739.2", "url": "https://www.ensembl.org/id/ENSMUSP00000125739.2" } ] } }, { "isoform_ac": "F7BWF9-1", "url": "", "sequence": { "sequence": "XGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKMNL", "length": 55, "header": "tr|F7BWF9-1|PSA3_MOUSE Computationally mapped isoform of Proteasome subunit alpha type-3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=1 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71041132, "end_pos": 71033666, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000162898.2", "url": "https://www.ensembl.org/id/ENSMUST00000162898.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125490.2", "url": "https://www.ensembl.org/id/ENSMUSP00000125490.2" } ] } }, { "isoform_ac": "F8WH02-1", "url": "", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSYWDQM", "length": 40, "header": "tr|F8WH02-1|F8WH02_MOUSE Computationally mapped isoform of Proteasome subunit alpha 3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=1 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71030113, "end_pos": 71021521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000071704.4", "url": "https://www.ensembl.org/id/ENSMUST00000071704.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000071624.4", "url": "https://www.ensembl.org/id/ENSMUSP00000071624.4" } ] } }, { "isoform_ac": "O70435-1", "url": "", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM", "length": 255, "header": "sp|O70435-1|PSA3_MOUSE Isoform 1 of Proteasome subunit alpha type-3 OS=Mus musculus OX=10090 GN=Psma3 PE=1 SV=3 CANONICAL=O70435-1" }, "locus": { "chromosome": "12", "start_pos": 71041166, "end_pos": 71021521, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000160027", "url": "https://www.ensembl.org/id/ENSMUST00000160027" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125548", "url": "https://www.ensembl.org/id/ENSMUSP00000125548" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "phospho.ELM", "id": "O70435", "url": "http://phospho.elm.eu.org/byAccession/O70435.html" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Ser243" }, { "start_pos": 250, "end_pos": 250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "PubMed", "id": "18630941", "url": "https://glygen.org/publication/PubMed/18630941" }, { "database": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "O70435", "url": "http://phospho.elm.eu.org/byAccession/O70435.html" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Ser250" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The complete primary structure of mouse 20S proteasomes.", "journal": "Immunogenetics", "date": "1999", "authors": "Elenich LA, Nandi D, Kent AE, McCluskey TS, Cruz M, Iyer MN, Woodward EC, Conn CW, Ochoa AL, Ginsburg DB, Monaco JJ", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "reference": [ { "type": "PubMed", "id": "10436176", "url": "https://glygen.org/publication/PubMed/10436176" } ] }, { "title": "Proteasome activator PA200 is required for normal spermatogenesis.", "journal": "Mol. Cell. Biol.", "date": "2006", "authors": "Khor B, Bredemeyer AL, Huang CY, Turnbull IR, Evans R, Maggi LB Jr, White JM, Walker LM, Carnes K, Hess RA, Sleckman BP", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "reference": [ { "type": "PubMed", "id": "16581775", "url": "https://glygen.org/publication/PubMed/16581775" } ] }, { "title": "Mapping the murine cardiac 26S proteasome complexes.", "journal": "Circ. Res.", "date": "2006", "authors": "Gomes AV, Zong C, Edmondson RD, Li X, Stefani E, Zhang J, Jones RC, Thyparambil S, Wang GW, Qiao X, Bardag-Gorce F, Ping P", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "reference": [ { "type": "PubMed", "id": "16857966", "url": "https://glygen.org/publication/PubMed/16857966" } ] }, { "title": "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry.", "journal": "Journal of proteome research", "date": "2007", "authors": "Dai J, Jin WH, Sheng QH, Shieh CH, Wu JR, Zeng R", "evidence": [ { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "UniProtKB", "id": "E0CX62", "url": "https://www.uniprot.org/uniprot/E0CX62" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zhou H, Ye M, Dong J, Han G, Jiang X, Wu R, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "UniProtKB", "id": "E0CX62", "url": "https://www.uniprot.org/uniprot/E0CX62" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "18630941", "url": "https://glygen.org/publication/PubMed/18630941" } ] }, { "title": "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Sweet SM, Bailey CM, Cunningham DL, Heath JK, Cooper HJ", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "UniProtKB", "id": "E0CX62", "url": "https://www.uniprot.org/uniprot/E0CX62" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" }, { "database": "iPTMnet", "id": "O70435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70435" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Immuno- and constitutive proteasome crystal structures reveal differences in substrate and inhibitor specificity.", "journal": "Cell", "date": "2012", "authors": "Huber EM, Basler M, Schwab R, Heinemeyer W, Kirk CJ, Groettrup M, Groll M", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "reference": [ { "type": "PubMed", "id": "22341445", "url": "https://glygen.org/publication/PubMed/22341445" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Protein Interaction between Ameloblastin and Proteasome Subunit alpha Type 3 Can Facilitate Redistribution of Ameloblastin Domains within Forming Enamel.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Geng S, White SN, Paine ML, Snead ML", "evidence": [ { "database": "RefSeq", "id": "NP_001297524", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297524" }, { "database": "RefSeq", "id": "NP_035314", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035314" } ], "reference": [ { "type": "PubMed", "id": "26070558", "url": "https://glygen.org/publication/PubMed/26070558" } ] } ], "pathway": [ { "id": "mmu:19167", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:19167", "resource": "KEGG Pathway" }, { "id": "R-MMU-1169091", "name": "Activation of NF-kappaB in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169091", "resource": "Reactome", "description": "Activation of NF-kappaB in B cells" }, { "id": "R-MMU-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1234176", "resource": "Reactome", "description": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "id": "R-MMU-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1236978", "resource": "Reactome", "description": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "id": "R-MMU-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-MMU-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-MMU-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-MMU-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174184", "resource": "Reactome", "description": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "id": "R-MMU-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-MMU-195253", "name": "Degradation of beta-catenin by the destruction complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-195253", "resource": "Reactome", "description": "Degradation of beta-catenin by the destruction complex" }, { "id": "R-MMU-202424", "name": "Downstream TCR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-202424", "resource": "Reactome", "description": "Downstream TCR signaling" }, { "id": "R-MMU-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-MMU-2871837", "name": "FCERI mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2871837", "resource": "Reactome", "description": "FCERI mediated NF-kB activation" }, { "id": "R-MMU-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-349425", "resource": "Reactome", "description": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "id": "R-MMU-350562", "name": "Regulation of ornithine decarboxylase (ODC)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-350562", "resource": "Reactome", "description": "Regulation of ornithine decarboxylase (ODC)" }, { "id": "R-MMU-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-MMU-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-450408", "resource": "Reactome", "description": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "id": "R-MMU-4608870", "name": "Asymmetric localization of PCP proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4608870", "resource": "Reactome", "description": "Asymmetric localization of PCP proteins" }, { "id": "R-MMU-4641257", "name": "Degradation of AXIN", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641257", "resource": "Reactome", "description": "Degradation of AXIN" }, { "id": "R-MMU-4641258", "name": "Degradation of DVL", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4641258", "resource": "Reactome", "description": "Degradation of DVL" }, { "id": "R-MMU-5358346", "name": "Hedgehog ligand biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358346", "resource": "Reactome", "description": "Hedgehog ligand biogenesis" }, { "id": "R-MMU-5607761", "name": "Dectin-1 mediated noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5607761", "resource": "Reactome", "description": "Dectin-1 mediated noncanonical NF-kB signaling" }, { "id": "R-MMU-5607764", "name": "CLEC7A (Dectin-1) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5607764", "resource": "Reactome", "description": "CLEC7A (Dectin-1) signaling" }, { "id": "R-MMU-5610780", "name": "Degradation of GLI1 by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610780", "resource": "Reactome", "description": "Degradation of GLI1 by the proteasome" }, { "id": "R-MMU-5610785", "name": "GLI3 is processed to GLI3R by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5610785", "resource": "Reactome", "description": "GLI3 is processed to GLI3R by the proteasome" }, { "id": "R-MMU-5632684", "name": "Hedgehog 'on' state", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5632684", "resource": "Reactome", "description": "Hedgehog 'on' state" }, { "id": "R-MMU-5658442", "name": "Regulation of RAS by GAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5658442", "resource": "Reactome", "description": "Regulation of RAS by GAPs" }, { "id": "R-MMU-5668541", "name": "TNFR2 non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5668541", "resource": "Reactome", "description": "TNFR2 non-canonical NF-kB pathway" }, { "id": "R-MMU-5676590", "name": "NIK-->noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5676590", "resource": "Reactome", "description": "NIK-->noncanonical NF-kB signaling" }, { "id": "R-MMU-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-MMU-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-MMU-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-MMU-68867", "name": "Assembly of the pre-replicative complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68867", "resource": "Reactome", "description": "Assembly of the pre-replicative complex" }, { "id": "R-MMU-68949", "name": "Orc1 removal from chromatin", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68949", "resource": "Reactome", "description": "Orc1 removal from chromatin" }, { "id": "R-MMU-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-MMU-69481", "name": "G2/M Checkpoints", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69481", "resource": "Reactome", "description": "G2/M Checkpoints" }, { "id": "R-MMU-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69601", "resource": "Reactome", "description": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "id": "R-MMU-75815", "name": "Ubiquitin-dependent degradation of Cyclin D", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75815", "resource": "Reactome", "description": "Ubiquitin-dependent degradation of Cyclin D" }, { "id": "R-MMU-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8852276", "resource": "Reactome", "description": "The role of GTSE1 in G2/M progression after G2 checkpoint" }, { "id": "R-MMU-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8854050", "resource": "Reactome", "description": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "id": "R-MMU-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "id": "R-MMU-8939902", "name": "Regulation of RUNX2 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8939902", "resource": "Reactome", "description": "Regulation of RUNX2 expression and activity" }, { "id": "R-MMU-8941858", "name": "Regulation of RUNX3 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8941858", "resource": "Reactome", "description": "Regulation of RUNX3 expression and activity" }, { "id": "R-MMU-8948751", "name": "Regulation of PTEN stability and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8948751", "resource": "Reactome", "description": "Regulation of PTEN stability and activity" }, { "id": "R-MMU-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-MMU-9020702", "name": "Interleukin-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9020702", "resource": "Reactome", "description": "Interleukin-1 signaling" }, { "id": "R-MMU-9755511", "name": "KEAP1-NFE2L2 pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9755511", "resource": "Reactome", "description": "KEAP1-NFE2L2 pathway" }, { "id": "R-MMU-9762114", "name": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9762114", "resource": "Reactome", "description": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2" }, { "id": "R-MMU-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "P18422-1", "protein_name": "Proteasome subunit alpha type-3", "gene_name": "Psma3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAKESLKEEDESDDDNM", "length": 255 }, "evidence": [ { "id": "45233875", "url": "http://www.informatics.jax.org/homology/45233875", "database": "MGI" }, { "id": "O70435", "url": "https://omabrowser.org/oma/group/O70435/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P21242-1", "protein_name": "Probable proteasome subunit alpha type-7", "gene_name": "PRE10", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE", "length": 288 }, "evidence": [ { "id": "O70435", "url": "https://omabrowser.org/oma/group/O70435/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P25788-1", "protein_name": "Proteasome subunit alpha type-3", "gene_name": "PSMA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM", "length": 255 }, "evidence": [ { "id": "45233875", "url": "http://www.informatics.jax.org/homology/45233875", "database": "MGI" }, { "id": "O70435", "url": "https://omabrowser.org/oma/group/O70435/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9V5C6-1", "protein_name": "Proteasome subunit alpha type-3", "gene_name": "Prosalpha7", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDNETH", "length": 253 }, "evidence": [ { "id": "O70435", "url": "https://omabrowser.org/oma/group/O70435/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "proteolysis involved in protein catabolic process", "id": "GO:0051603", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051603", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "regulation of endopeptidase activity", "id": "GO:0052548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052548", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "proteasomal protein catabolic process", "id": "GO:0010498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010498", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "proteasome core complex, alpha-subunit complex", "id": "GO:0019773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019773", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "proteasome core complex", "id": "GO:0005839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005839", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" }, { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "O70435", "url": "https://www.uniprot.org/uniprot/O70435" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 33, "end_pos": 35, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }