{ "uniprot_canonical_ac": "O70361-1", "uniprot_ac": "O70361", "uniprot_id": "PER3_MOUSE", "mass": { "chemical_mass": 120911.0, "monoisotopic_mass": 120911.0 }, "refseq": { "ac": "NP_035197", "name": "period circadian protein homolog 3 isoform 2", "summary": "This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been linked to sleep disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" }, "gene_names": [ { "name": "Per3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O70361", "id": "O70361" }, { "name": "2810049O06Rik; mPer3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197", "id": "NP_035197" }, { "name": "Per3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197", "id": "NP_035197" } ], "protein_names": [ { "name": "Period circadian protein homolog 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O70361" }, { "name": "Circadian clock protein PERIOD 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70361" }, { "name": "mPER3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70361" }, { "name": "period circadian protein homolog 3 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197", "id": "NP_035197" }, { "name": "period circadian protein homolog 3; period homolog 3; circadian clock protein PERIOD 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197", "id": "NP_035197" } ], "function": [ { "annotation": "Originally described as a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, BMAL1, BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and BMAL1 or BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-BMAL1|BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1, NR1D2, RORA, RORB and RORG, which form a second feedback loop and which activate and repress BMAL1 transcription, respectively. Has a redundant role with the other PER proteins PER1 and PER2 and is not essential for the circadian rhythms maintenance. In contrast, plays an important role in sleep-wake timing and sleep homeostasis probably through the transcriptional regulation of sleep homeostasis-related genes, without influencing circadian parameters. Can bind heme.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361#function" }, { "database": "PubMed", "id": "21957163", "url": "https://glygen.org/publication/PubMed/21957163" }, { "database": "PubMed", "id": "22331899", "url": "https://glygen.org/publication/PubMed/22331899" }, { "database": "PubMed", "id": "11395012", "url": "https://glygen.org/publication/PubMed/11395012" } ] }, { "annotation": "Period genes not only orchestrate dynamic changes in metabolic activity, but also regulate homeostatic self-renewal of hepatocytes through Mkp1-Erk1/2 signaling pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" }, { "database": "PubMed", "id": "29269828", "url": "https://glygen.org/publication/PubMed/29269828" } ] }, { "annotation": "The findings demonstrate that Per3 has a major role in the APC clock and regulates adipogenesis in vivo.", "evidence": [ { "database": "RefSeq", "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" }, { "database": "PubMed", "id": "29186676", "url": "https://glygen.org/publication/PubMed/29186676" } ] }, { "annotation": "This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been linked to sleep disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" } ] } ], "disease": [ { "disease_id": "DOID:0050628", "recommended_name": { "id": "DOID:0050628", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050628", "name": "advanced sleep phase syndrome", "description": "A sleep disorder that involves an altered circadian rhythm resulting in falling asleep in early evening and awaking very early in the morning." }, "synonyms": [ { "id": "DOID:0050628", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050628", "name": "familial advanced sleep-phase syndrome", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome 1", "description": "Any advanced sleep phase syndrome in which the cause of the disease is a mutation in the PER2 gene." }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "FASPS1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "PER2 advanced sleep phase syndrome", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome caused by mutation in PER2", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome type 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome, familial, type 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "familial advanced sleep phase syndrome 1", "description": "" }, { "id": "MONDO:0011442", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011442", "name": "advanced sleep phase syndrome, familial, 1", "description": "" }, { "id": "MIM:604348", "resource": "MIM", "url": "https://www.omim.org/entry/604348", "name": "Advanced sleep phase syndrome, familial, 1", "description": "Advanced sleep phase syndrome, familial, 1" } ], "evidence": [ { "id": "0050628", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050628" } ] }, { "disease_id": "DOID:0110013", "recommended_name": { "id": "DOID:0110013", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110013", "name": "advanced sleep phase syndrome 3", "description": "An advanced sleep phase syndrome that has_material_basis_in heterozygous mutation in the PER3 gene on chromosome 1p36.23." }, "synonyms": [ { "id": "DOID:0110013", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110013", "name": "FASPS3", "description": "" }, { "id": "DOID:0110013", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110013", "name": "familial advanced sleep phase syndrome 3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "advanced sleep phase syndrome 3", "description": "Any advanced sleep phase syndrome in which the cause of the disease is a mutation in the PER3 gene." }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "FASPS3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "PER3 advanced sleep phase syndrome", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "advanced sleep phase syndrome caused by mutation in PER3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "advanced sleep phase syndrome type 3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "advanced sleep phase syndrome, familial, 3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "advanced sleep phase syndrome, familial, type 3", "description": "" }, { "id": "MONDO:0014814", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014814", "name": "familial advanced sleep phase syndrome 3", "description": "" }, { "id": "MIM:616882", "resource": "MIM", "url": "https://www.omim.org/entry/616882", "name": "Advanced sleep phase syndrome, familial, 3", "description": "Advanced sleep phase syndrome, familial, 3" } ], "evidence": [ { "id": "0110013", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110013" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 359, "end_pos": 359, "sequence_org": "W", "sequence_mut": "E", "comment": "Abolishes homodimerization.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" }, { "database": "PubMed", "id": "22331899", "url": "https://glygen.org/publication/PubMed/22331899" } ] }, { "start_pos": 367, "end_pos": 367, "sequence_org": "I", "sequence_mut": "E", "comment": "Abolishes homodimerization.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" }, { "database": "PubMed", "id": "22331899", "url": "https://glygen.org/publication/PubMed/22331899" } ] }, { "start_pos": 613, "end_pos": 627, "sequence_org": "SVASGISQCSCSSTS", "sequence_mut": "AVAAGIAQCACAATA", "comment": "No effect on interaction with BTRC and FBXW11.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" }, { "database": "PubMed", "id": "15917222", "url": "https://glygen.org/publication/PubMed/15917222" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Per3", "url": "https://www.uniprot.org/uniprot/O70361", "locus": { "chromosome": "4", "start_pos": 151088109, "end_pos": 151129122, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028957", "url": "https://www.ensembl.org/id/ENSMUSG00000028957" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028957", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028957", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00130", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00130", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "18628", "url": "https://www.ncbi.nlm.nih.gov/gene/18628", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O70361", "url": "https://www.ebi.ac.uk/intact/interactors/id:O70361*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013655", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013655", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022728", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022728", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18628", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18628", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1277134", "url": "http://www.informatics.jax.org/marker/MGI:1277134", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EYQCVAG", "url": "https://omabrowser.org/oma/group/EYQCVAG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11269", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11269", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11269:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11269:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4DJ3", "url": "https://www.rcsb.org/structure/4DJ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08447", "url": "http://pfam.xfam.org/family/PF08447", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12114", "url": "http://pfam.xfam.org/family/PF12114", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O70361", "url": "http://purl.obolibrary.org/obo/PR_O70361", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9PV88", "url": "https://www.uniprot.org/uniprot/E9PV88", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PV88-1", "url": "https://www.uniprot.org/uniprot/E9PV88-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70361-1", "url": "https://www.uniprot.org/uniprot/O70361-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS", "length": 1113, "header": "sp|O70361-1|PER3_MOUSE Isoform 1 of Period circadian protein homolog 3 OS=Mus musculus OX=10090 GN=Per3 PE=1 SV=2 CANONICAL=O70361-1" }, "isoforms": [ { "isoform_ac": "E9PV88-1", "url": "", "sequence": { "sequence": "MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTYCVRGTTRRVTRHSHVEIRGHLRWSIFSPGLWDQTPVIRLAQQTVLPTAPSQ", "length": 426, "header": "tr|E9PV88-1|E9PV88_MOUSE Computationally mapped isoform of Period circadian clock 3 OS=Mus musculus OX=10090 GN=Per3 PE=4 SV=1 CANONICAL=O70361-1" }, "locus": { "chromosome": "4", "start_pos": 151128689, "end_pos": 151111705, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000136398.8", "url": "https://www.ensembl.org/id/ENSMUST00000136398.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118950.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118950.2" } ] } }, { "isoform_ac": "O70361-1", "url": "", "sequence": { "sequence": "MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS", "length": 1113, "header": "sp|O70361-1|PER3_MOUSE Isoform 1 of Period circadian protein homolog 3 OS=Mus musculus OX=10090 GN=Per3 PE=1 SV=2 CANONICAL=O70361-1" }, "locus": { "chromosome": "4", "start_pos": 151128689, "end_pos": 151090336, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103204", "url": "https://www.ensembl.org/id/ENSMUST00000103204" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099493", "url": "https://www.ensembl.org/id/ENSMUSP00000099493" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 907, "end_pos": 907, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "site_lbl": "Ser907" } ], "glycation": [], "keywords": [], "publication": [ { "title": "mCRY1 and mCRY2 are essential components of the negative limb of the circadian clock feedback loop.", "journal": "Cell", "date": "1999", "authors": "Kume K, Zylka MJ, Sriram S, Shearman LP, Weaver DR, Jin X, Maywood ES, Hastings MH, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "10428031", "url": "https://glygen.org/publication/PubMed/10428031" } ] }, { "title": "Differential functions of mPer1, mPer2, and mPer3 in the SCN circadian clock.", "journal": "Neuron", "date": "2001", "authors": "Jin X., Reppert S.M., Weaver D.R., Hastings M.H., Maywood E.S., Bae K.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "11395012", "url": "https://glygen.org/publication/PubMed/11395012" } ] }, { "title": "Nuclear export of mammalian PERIOD proteins.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Vielhaber EL, Duricka D, Ullman KS, Virshup DM", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "11591712", "url": "https://glygen.org/publication/PubMed/11591712" } ] }, { "title": "Control of intracellular dynamics of mammalian period proteins by casein kinase I epsilon (CKIepsilon) and CKIdelta in cultured cells.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Akashi M, Tsuchiya Y, Yoshino T, Nishida E", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "11865049", "url": "https://glygen.org/publication/PubMed/11865049" } ] }, { "title": "Requirement of mammalian Timeless for circadian rhythmicity.", "journal": "Science", "date": "2003", "authors": "Mitchell J.W., Tischkau S.A., Barnes J.A., Barnes J.W., Burgoon P.W., Gillette M.U., Hickok J.R.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "14564007", "url": "https://glygen.org/publication/PubMed/14564007" } ] }, { "title": "Direct association between mouse PERIOD and CKIepsilon is critical for a functioning circadian clock.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Lee C, Weaver DR, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "14701732", "url": "https://glygen.org/publication/PubMed/14701732" } ] }, { "title": "SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Shirogane T, Jin J, Ang XL, Harper JW", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "15917222", "url": "https://glygen.org/publication/PubMed/15917222" } ] }, { "title": "Altered sleep and behavioral activity phenotypes in PER3-deficient mice.", "journal": "Am. J. Physiol.", "date": "2011", "authors": "Hasan S., Archer S.N., Dijk D.J., Winsky-Sommerer R., van der Veen D.R.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "21957163", "url": "https://glygen.org/publication/PubMed/21957163" } ] }, { "title": "Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Kucera N, Schmalen I, Hennig S, Ollinger R, Strauss HM, Grudziecki A, Wieczorek C, Kramer A, Wolf E", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "22331899", "url": "https://glygen.org/publication/PubMed/22331899" } ] }, { "title": "Metabolism and the circadian clock converge.", "journal": "Physiol. Rev.", "date": "2013", "authors": "Sassone-Corsi P., Eckel-Mahan K.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "23303907", "url": "https://glygen.org/publication/PubMed/23303907" } ] }, { "title": "Molecular architecture of the mammalian circadian clock.", "journal": "Trends Cell Biol.", "date": "2014", "authors": "Takahashi J.S., Green C.B., Partch C.L.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "23916625", "url": "https://glygen.org/publication/PubMed/23916625" } ] }, { "title": "A PERIOD3 variant causes a circadian phenotype and is associated with a seasonal mood trait.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2016", "authors": "Zhang L, Hirano A, Hsu PK, Jones CR, Sakai N, Okuro M, McMahon T, Yamazaki M, Xu Y, Saigoh N, Saigoh K, Lin ST, Kaasik K, Nishino S, Ptacek LJ, Fu YH", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "26903630", "url": "https://glygen.org/publication/PubMed/26903630" } ] }, { "title": "The Circadian Clock Regulates Adipogenesis by a Per3 Crosstalk Pathway to Klf15.", "journal": "Cell reports", "date": "2017", "authors": "Aggarwal A, Costa MJ, Rivero-Gutierrez B, Ji L, Morgan SL, Feldman BJ", "evidence": [ { "database": "RefSeq", "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" } ], "reference": [ { "type": "PubMed", "id": "29186676", "url": "https://glygen.org/publication/PubMed/29186676" } ] }, { "title": "Circadian clock regulates hepatic polyploidy by modulating Mkp1-Erk1/2 signaling pathway.", "journal": "Nature communications", "date": "2017", "authors": "Chao HW, Doi M, Fustin JM, Chen H, Murase K, Maeda Y, Hayashi H, Tanaka R, Sugawa M, Mizukuchi N, Yamaguchi Y, Yasunaga JI, Matsuoka M, Sakai M, Matsumoto M, Hamada S, Okamura H", "evidence": [ { "database": "RefSeq", "id": "NP_035197", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035197" } ], "reference": [ { "type": "PubMed", "id": "29269828", "url": "https://glygen.org/publication/PubMed/29269828" } ] }, { "title": "Three period homologs in mammals: differential light responses in the suprachiasmatic circadian clock and oscillating transcripts outside of brain.", "journal": "Neuron", "date": "1998", "authors": "Zylka MJ, Shearman LP, Weaver DR, Reppert SM", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "reference": [ { "type": "PubMed", "id": "9655499", "url": "https://glygen.org/publication/PubMed/9655499" } ] } ], "pathway": [ { "id": "mmu:18628", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18628", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P56645-1", "protein_name": "Period circadian protein homolog 3", "gene_name": "PER3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAALILNRKKDVLASSHFVDLLAPQDMRVFYAHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCHSPFRIIPYLIHVHHPAQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQDLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFVNPWSRKISFIIGRHKVRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVSSGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQINCIDSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMPTNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYFQGDSTSKQTRSAGCRKGKHKRKKLPEPPDSSSSNTGSGPRRGAHQNAQPCCPSAASSPHTSSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLHGLPLSEGLQPYPAFPFPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQRREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNNGSESSPATTGALSTGSPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSHPTASTLSMGLPPSRTPSHPTATVLSTGSPPSESPSRTGSAASGSSDSSIYLTSSVYSSKISQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC", "length": 1201 }, "evidence": [ { "id": "45225259", "url": "http://www.informatics.jax.org/homology/45225259", "database": "MGI" }, { "id": "O70361", "url": "https://omabrowser.org/oma/group/O70361/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CJE2-1", "protein_name": "Period circadian protein homolog 3", "gene_name": "Per3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPCGNPAVPGGDCPQTRGPGLQGSSGQEGPLQGICVDSSHSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSEFFQSLSPRGARQAEATVYNLEELTSLASEHTSKNTDTFVAVFSFLSGRLVHISEQAAWILNSKKGFLKSLHFVDLLAPRDVRVFYAHTAPTQLPFWNTWTQRASQYECAPVKPFFCRICGGGDREQKRHYSPFRILPYLVHVHSPAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRVFTTTHTPGCVFLEVDERAVPLLGFLPQDLIGTSILTYLHPEDRPLMVAVHQKVLKYVGHPPFEHSPIRFCTQNGDYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKATSHDEDITELQEQIHRLLLQPVHASASSGYGSLGSSGSQEQHISVTSSSESSGHCVEEAQQEQMTLQQVYASVNKIKNVGQQLYIESMARSSVKPVMETCTEPQGSDEQKDFSSSQTLKNKSTDTGSGGDLRPEQHSSSYQQMNCIDSVIRYLTSYSFPALKRKCISCTNTSSSSEEAKPNPEADGSLRDTEQLLDIPEQETTTPSADAEGGVARTLSTAALSMASGVSQCSCSSTTDHVPPLQSESVAGACEPWALRTKAHVTAEGFKPVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQEGRNHAKYACVVGAGATPKHSRCAGSERRKHKRKKLPTPVDSSSSSAHLCPHVRGLLPDVQHWSASVTSPCATGLALPSALVVPNQTPYLLSSFPLQDMAPHGVGDSAPWGAAAECPPLSAGPHPVSTFPSAYMGTFMTVLLHNSPLFPLWPASFSPYPFLGATGPSQMAPLVPAMAPDLEPTPSDHGPRRVEENWETHSEEEHPFISSRSSSPLQLNLLQEEMPAPSEYADALRRGACPDAKQLCVTGNSGSRSPPCATGELATASVQQESPSAAASGSSASSVHGSGSDYTSEVSENGQRSQDTHRDRAFSGAAEESIWRMIERTPQCVLMTYQVPERGRDTVLREDLEKLHSMERQRPQFSSAQKEELAKVRSWIHSHPAPEERQLQRAMSPVKTEVQLVTLQRPVNSVQQKTPVEQL", "length": 1119 }, "evidence": [ { "id": "45225259", "url": "http://www.informatics.jax.org/homology/45225259", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "regulation of circadian sleep/wake cycle, sleep", "id": "GO:0045187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045187", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "entrainment of circadian clock by photoperiod", "id": "GO:0043153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043153", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" }, { "name": "transcription corepressor binding", "id": "GO:0001222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001222", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 509, "end_pos": 511, "annotation": "n_glycosylation_sequon" }, { "start_pos": 560, "end_pos": 562, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation by CSNK1E is weak and appears to require association with PER1 and translocation to the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" }, { "database": "PubMed", "id": "14701732", "url": "https://glygen.org/publication/PubMed/14701732" }, { "database": "PubMed", "id": "11865049", "url": "https://glygen.org/publication/PubMed/11865049" } ] }, { "annotation": "Ubiquitinated.", "evidence": [ { "database": "UniProtKB", "id": "O70361", "url": "https://www.uniprot.org/uniprot/O70361" }, { "database": "PubMed", "id": "11865049", "url": "https://glygen.org/publication/PubMed/11865049" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }