{ "uniprot_canonical_ac": "O70252-1", "uniprot_ac": "O70252", "uniprot_id": "HMOX2_MOUSE", "mass": { "chemical_mass": 35739.0, "monoisotopic_mass": 35739.0 }, "refseq": { "ac": "NP_001129538", "name": "heme oxygenase 2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538" }, "gene_names": [ { "name": "Hmox2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O70252", "id": "O70252" }, { "name": "HO-2; HO2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538", "id": "NP_001129538" }, { "name": "Hmox2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538", "id": "NP_001129538" } ], "protein_names": [ { "name": "Heme oxygenase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O70252" }, { "name": "1.14.14.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70252" }, { "name": "HO-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O70252" }, { "name": "heme oxygenase (decycling) 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538", "id": "NP_001129538" }, { "name": "heme oxygenase 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538", "id": "NP_001129538" } ], "function": [ { "annotation": "Aged male mice are hypersensitive to ischemic acute kidney injury and HO-2 mitigates such sensitivity. This protective effect of HO-2 may be mediated, at least in part, by suppression of phosphorylated STAT3-dependent signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_001129538", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538" }, { "database": "PubMed", "id": "31215802", "url": "https://glygen.org/publication/PubMed/31215802" } ] }, { "annotation": "Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron.", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252#function" }, { "database": "UniProtKB", "id": "P30519", "url": "https://www.uniprot.org/uniprot/P30519#function" } ] }, { "annotation": "Heme Oxygenase 1 and 2 Differentially Regulate Glucose Metabolism and Adipose Tissue Mitochondrial Respiration: Implications for Metabolic Dysregulation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001129538", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538" }, { "database": "PubMed", "id": "32992485", "url": "https://glygen.org/publication/PubMed/32992485" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Hmox2", "url": "https://www.uniprot.org/uniprot/O70252", "locus": { "chromosome": "16", "start_pos": 4584606, "end_pos": 4544225, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000004070", "url": "https://www.ensembl.org/id/ENSMUSG00000004070" } ] } } ], "crossref": [ { "id": "ENSMUSG00000004070", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000004070", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.14.14.18", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.18&UniProtAcc=O70252", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd19165", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19165", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "15369", "url": "https://www.ncbi.nlm.nih.gov/gene/15369", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O70252", "url": "https://www.ebi.ac.uk/intact/interactors/id:O70252*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016084", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016084", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018207", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018207", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15369", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15369", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "109373", "url": "http://www.informatics.jax.org/marker/MGI:109373", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "O70252", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O70252", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ANRAFEY", "url": "https://omabrowser.org/oma/group/ANRAFEY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1366343at2759", "url": "http://www.orthodb.org/?query=1366343at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10720", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10720:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01126", "url": "http://pfam.xfam.org/family/PF01126", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O70252", "url": "http://purl.obolibrary.org/obo/PR_O70252", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917937", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9707564", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9707564", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001129538", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "21764", "url": "https://www.rhea-db.org/rhea/21764", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "D3YX62", "url": "https://www.uniprot.org/uniprot/D3YX62", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YX62-1", "url": "https://www.uniprot.org/uniprot/D3YX62-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YXN4", "url": "https://www.uniprot.org/uniprot/D3YXN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YXN4-1", "url": "https://www.uniprot.org/uniprot/D3YXN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z4A2", "url": "https://www.uniprot.org/uniprot/D3Z4A2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z4A2-1", "url": "https://www.uniprot.org/uniprot/D3Z4A2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O70252-1", "url": "https://www.uniprot.org/uniprot/O70252-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEYNMQIFSELDQAGSMLARETLEDGLPVHDGKGDIRKCPFYAAQPDKGTLGGSNCPFQTTVAVLRKPSLQLILAASVALVAGLLAWYYM", "length": 315, "header": "sp|O70252-1|HMOX2_MOUSE Isoform 1 of Heme oxygenase 2 OS=Mus musculus OX=10090 GN=Hmox2 PE=1 SV=1 CANONICAL=O70252-1" }, "isoforms": [ { "isoform_ac": "D3YX62-1", "url": "", "sequence": { "sequence": "MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEY", "length": 228, "header": "tr|D3YX62-1|HMOX2_MOUSE Computationally mapped isoform of Heme oxygenase 2 OS=Mus musculus OX=10090 GN=Hmox2 PE=1 SV=1 CANONICAL=O70252-1" }, "locus": { "chromosome": "16", "start_pos": 4582952, "end_pos": 4580459, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000121529.2", "url": "https://www.ensembl.org/id/ENSMUST00000121529.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000112378.2", "url": "https://www.ensembl.org/id/ENSMUSP00000112378.2" } ] } }, { "isoform_ac": "D3YXN4-1", "url": "", "sequence": { "sequence": "MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAF", "length": 93, "header": "tr|D3YXN4-1|HMOX2_MOUSE Computationally mapped isoform of Heme oxygenase 2 OS=Mus musculus OX=10090 GN=Hmox2 PE=1 SV=1 CANONICAL=O70252-1" }, "locus": { "chromosome": "16", "start_pos": 4582547, "end_pos": 4580459, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000140367.8", "url": "https://www.ensembl.org/id/ENSMUST00000140367.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115932.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115932.2" } ] } }, { "isoform_ac": "D3Z4A2-1", "url": "", "sequence": { "sequence": "MDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELL", "length": 65, "header": "tr|D3Z4A2-1|HMOX2_MOUSE Computationally mapped isoform of Heme oxygenase 2 OS=Mus musculus OX=10090 GN=Hmox2 PE=1 SV=1 CANONICAL=O70252-1" }, "locus": { "chromosome": "16", "start_pos": 4582712, "end_pos": 4582518, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000154117.2", "url": "https://www.ensembl.org/id/ENSMUST00000154117.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122699.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122699.2" } ] } }, { "isoform_ac": "O70252-1", "url": "", "sequence": { "sequence": "MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEYNMQIFSELDQAGSMLARETLEDGLPVHDGKGDIRKCPFYAAQPDKGTLGGSNCPFQTTVAVLRKPSLQLILAASVALVAGLLAWYYM", "length": 315, "header": "sp|O70252-1|HMOX2_MOUSE Isoform 1 of Heme oxygenase 2 OS=Mus musculus OX=10090 GN=Hmox2 PE=1 SV=1 CANONICAL=O70252-1" }, "locus": { "chromosome": "16", "start_pos": 4583966, "end_pos": 4580459, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118885", "url": "https://www.ensembl.org/id/ENSMUST00000118885" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113110", "url": "https://www.ensembl.org/id/ENSMUSP00000113110" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O70252", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O70252" }, { "id": "28528544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28528544" } ] } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The New Chemical Reporter 6-Alkynyl-6-deoxy-GlcNAc Reveals O-GlcNAc Modification of the Apoptotic Caspases That Can Block the Cleavage/Activation of Caspase-8.", "journal": "Journal of the American Chemical Society", "date": "2017", "authors": "Chuh KN, Batt AR, Zaro BW, Darabedian N, Marotta NP, Brennan CK, Amirhekmat A, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "O70252", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O70252" } ], "reference": [ { "type": "PubMed", "id": "28528544", "url": "https://glygen.org/publication/PubMed/28528544" } ] }, { "title": "Heme oxygenase-2 protects against ischemic acute kidney injury: influence of age and sex.", "journal": "American journal of physiology. Renal physiology", "date": "2019", "authors": "Nath KA, Garovic VD, Grande JP, Croatt AJ, Ackerman AW, Farrugia G, Katusic ZS, Belcher JD, Vercellotti GM", "evidence": [ { "database": "RefSeq", "id": "NP_001129538", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538" } ], "reference": [ { "type": "PubMed", "id": "31215802", "url": "https://glygen.org/publication/PubMed/31215802" } ] }, { "title": "Heme Oxygenase 1 and 2 Differentially Regulate Glucose Metabolism and Adipose Tissue Mitochondrial Respiration: Implications for Metabolic Dysregulation.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Yao H, Peterson AL, Li J, Xu H, Dennery PA", "evidence": [ { "database": "RefSeq", "id": "NP_001129538", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129538" } ], "reference": [ { "type": "PubMed", "id": "32992485", "url": "https://glygen.org/publication/PubMed/32992485" } ] }, { "title": "The identification and expression of heme oxygenase-2 alternative transcripts in the mouse.", "journal": "Gene", "date": "1998", "authors": "Morgan M.J., Gibbs L., Willis D.", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "reference": [ { "type": "PubMed", "id": "9795203", "url": "https://glygen.org/publication/PubMed/9795203" } ] } ], "pathway": [ { "id": "mmu:15369", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15369", "resource": "KEGG Pathway" }, { "id": "R-MMU-189483", "name": "Heme degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189483", "resource": "Reactome", "description": "Heme degradation" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-MMU-8980692", "name": "RHOA GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8980692", "resource": "Reactome", "description": "RHOA GTPase cycle" }, { "id": "R-MMU-917937", "name": "Iron uptake and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917937", "resource": "Reactome", "description": "Iron uptake and transport" }, { "id": "R-MMU-9707564", "name": "Cytoprotection by HMOX1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9707564", "resource": "Reactome", "description": "Cytoprotection by HMOX1" } ], "orthologs": [ { "uniprot_canonical_ac": "P23711-1", "protein_name": "Heme oxygenase 2", "gene_name": "Hmox2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENWEEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAGSMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILAASVALVAGLLAWYYM", "length": 315 }, "evidence": [ { "id": "45237083", "url": "http://www.informatics.jax.org/homology/45237083", "database": "MGI" }, { "id": "O70252", "url": "https://omabrowser.org/oma/group/O70252/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P30519-1", "protein_name": "Heme oxygenase 2", "gene_name": "HMOX2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM", "length": 316 }, "evidence": [ { "id": "45237083", "url": "http://www.informatics.jax.org/homology/45237083", "database": "MGI" }, { "id": "O70252", "url": "https://omabrowser.org/oma/group/O70252/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "heme oxygenase (decyclizing) activity", "id": "GO:0004392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004392", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "heme oxidation", "id": "GO:0006788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006788", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "heme catabolic process", "id": "GO:0042167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042167", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "A soluble form arises by proteolytic removal of the membrane anchor.", "evidence": [ { "database": "UniProtKB", "id": "O70252", "url": "https://www.uniprot.org/uniprot/O70252" }, { "database": "PubMed", "id": "P30519", "url": "https://glygen.org/publication/PubMed/P30519" } ] } ], "interactions": [], "reactions": [ { "id": "21764", "name": "", "equation": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06762-1", "O70453-1", "P23711-1", "P09601-1", "P30519-1", "O70252-1", "P14901-1", "Q9VGJ9-1" ], "evidence": [ { "id": "21764", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21764" } ] }, { "id": "R-MMU-189398", "name": "HMOX1 dimer, HMOX2 cleave heme", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-189385", "R-ALL-189396", "R-ALL-71067" ], "enzyme_list": [ "O70252-1", "P14901-1" ], "evidence": [ { "id": "R-MMU-189398", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-189398" } ] }, { "id": "R-MMU-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64455-1", "O09005-1", "Q9Z280-1", "O35598-1", "P70704-1", "P62482-1", "B2RU80-1", "Q9Z2A7-1", "O35488-1", "A2AN08-1", "P98197-1", "Q61093-1", "O70252-1", "Q3UDW8-1", "Q80VQ0-1", "Q64277-1", "Q8K3K7-1", "Q3U435-1", "P62835-1", "O55098-1", "P61226-1", "Q05910-1", "P06869-1", "A2ANX3-1" ], "evidence": [ { "id": "R-MMU-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6799350" } ] }, { "id": "R-MMU-9013009", "name": "RHOA binds effectors at the plasma membrane", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70268-1", "Q8BWW9-1", "Q9Z280-1", "Q9QUI0-1", "P55096-1", "P70335-1", "O54988-1", "O70252-1", "Q8K045-1", "P70336-1", "O55098-1", "P68033-1" ], "evidence": [ { "id": "R-MMU-9013009", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9013009" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-189385", "participant_name": "CO [cytosol]", "crossref": [ { "id": "C00237", "database": "COMPOUND", "url": "" }, { "id": "17245", "database": "ChEBI", "url": "" }, { "id": "HMDB0001361", "database": "HMDB Metabolite", "url": "" }, { "id": "9531", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00237", "database": "COMPOUND", "url": "" }, { "id": "17245", "database": "ChEBI", "url": "" }, { "id": "HMDB0001361", "database": "HMDB Metabolite", "url": "" }, { "id": "9531", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00237", "database": "COMPOUND", "url": "" }, { "id": "17245", "database": "ChEBI", "url": "" }, { "id": "HMDB0001361", "database": "HMDB Metabolite", "url": "" }, { "id": "9531", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-189396", "participant_name": "BV [cytosol]", "crossref": [ { "id": "000053276076", "database": "ZINC", "url": "" }, { "id": "C00500", "database": "COMPOUND", "url": "" }, { "id": "57991", "database": "ChEBI", "url": "" }, { "id": "C00500", "database": "COMPOUND", "url": "" }, { "id": "57991", "database": "ChEBI", "url": "" }, { "id": "000053276076", "database": "ZINC", "url": "" }, { "id": "C00500", "database": "COMPOUND", "url": "" }, { "id": "57991", "database": "ChEBI", "url": "" }, { "id": "000053276076", "database": "ZINC", "url": "" }, { "id": "C00500", "database": "COMPOUND", "url": "" }, { "id": "57991", "database": "ChEBI", "url": "" }, { "id": "000053276076", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-71067", "participant_name": "Fe2+ [cytosol]", "crossref": [ { "id": "C14818", "database": "COMPOUND", "url": "" }, { "id": "27284", "database": "PubChem Compound", "url": "" }, { "id": "29033", "database": "ChEBI", "url": "" }, { "id": "C14818", "database": "KEGG Gene", "url": "" }, { "id": "HMDB0000692", "database": "HMDB Metabolite", "url": "" }, { "id": "C00023", "database": "COMPOUND", "url": "" }, { "id": "FE+2", "database": "AraCyc", "url": "" }, { "id": "C00023", "database": "COMPOUND", "url": "" }, { "id": "29033", "database": "ChEBI", "url": "" }, { "id": "HMDB0000692", "database": "HMDB Metabolite", "url": "" }, { "id": "C14818", "database": "COMPOUND", "url": "" }, { "id": "FE+2", "database": "AraCyc", "url": "" }, { "id": "27284", "database": "PubChem Compound", "url": "" }, { "id": "C14818", "database": "KEGG Gene", "url": "" }, { "id": "C00023", "database": "COMPOUND", "url": "" }, { "id": "29033", "database": "ChEBI", "url": "" }, { "id": "HMDB0000692", "database": "HMDB Metabolite", "url": "" }, { "id": "C14818", "database": "COMPOUND", "url": "" }, { "id": "FE+2", "database": "AraCyc", "url": "" }, { "id": "27284", "database": "PubChem Compound", "url": "" }, { "id": "C14818", "database": "KEGG Gene", "url": "" }, { "id": "C14818", "database": "KEGG Gene", "url": "" }, { "id": "HMDB0000692", "database": "HMDB Metabolite", "url": "" }, { "id": "FE+2", "database": "AraCyc", "url": "" }, { "id": "C00023", "database": "COMPOUND", "url": "" }, { "id": "C14818", "database": "COMPOUND", "url": "" }, { "id": "27284", "database": "PubChem Compound", "url": "" }, { "id": "29033", "database": "ChEBI", "url": "" }, { "id": "C00023", "database": "COMPOUND", "url": "" }, { "id": "29033", "database": "ChEBI", "url": "" }, { "id": "HMDB0000692", "database": "HMDB Metabolite", "url": "" }, { "id": "C14818", "database": "COMPOUND", "url": "" }, { "id": "FE+2", "database": "AraCyc", "url": "" }, { "id": "27284", "database": "PubChem Compound", "url": "" }, { "id": "C14818", "database": "KEGG Gene", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2AN08", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] } ] }, { "uniprot_ac": "A2ANX3", "gene_name": "Atp8b4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] } ] }, { "uniprot_ac": "B2RU80", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] } ] }, { "uniprot_ac": "O09005", "gene_name": "Degs1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] } ] }, { "uniprot_ac": "O35488", "gene_name": "Slc27a2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] } ] }, { "uniprot_ac": "O35598", "gene_name": "Adam10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] } ] }, { "uniprot_ac": "O54988", "gene_name": "Slk", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O54988", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54988" } ] } ] }, { "uniprot_ac": "O55098", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] } ] }, { "uniprot_ac": "O70252", "gene_name": "Hmox2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] } ] }, { "uniprot_ac": "O70453", "gene_name": "Hmox3", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O70453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70453" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "O70453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70453" } ] } ] }, { "uniprot_ac": "P06762", "gene_name": "Hmox1", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P06762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06762" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P06762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06762" } ] } ] }, { "uniprot_ac": "P06869", "gene_name": "Plau", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] } ] }, { "uniprot_ac": "P09601", "gene_name": "HMOX1", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P09601", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09601" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P09601", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09601" } ] } ] }, { "uniprot_ac": "P14901", "gene_name": "Hmox1", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P14901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14901" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P14901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14901" } ] } ] }, { "uniprot_ac": "P23711", "gene_name": "Hmox2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P23711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23711" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P23711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23711" } ] } ] }, { "uniprot_ac": "P30519", "gene_name": "HMOX2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] } ] }, { "uniprot_ac": "P55096", "gene_name": "Abcd3", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P62482", "gene_name": "Kcnab2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P62482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62482" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P68033", "gene_name": "Actc1", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P68033", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68033" } ] } ] }, { "uniprot_ac": "P70268", "gene_name": "Pkn1", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "P70268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70268" } ] } ] }, { "uniprot_ac": "P70335", "gene_name": "Rock1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] } ] }, { "uniprot_ac": "P70336", "gene_name": "Rock2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70336" } ] } ] }, { "uniprot_ac": "P70704", "gene_name": "Atp8a1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] } ] }, { "uniprot_ac": "P98197", "gene_name": "Atp11a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] } ] }, { "uniprot_ac": "Q05910", "gene_name": "Adam8", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q05910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05910" } ] } ] }, { "uniprot_ac": "Q3U435", "gene_name": "Mmp25", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q3U435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U435" } ] } ] }, { "uniprot_ac": "Q3UDW8", "gene_name": "Hgsnat", "activity": [ { "ec_number": "2.3.1.78", "activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] }, { "ec_number": "2.3.1.78", "activity": "", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] } ] }, { "uniprot_ac": "Q61093", "gene_name": "Cybb", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q61093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61093" } ] } ] }, { "uniprot_ac": "Q64277", "gene_name": "Bst1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] } ] }, { "uniprot_ac": "Q64455", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] } ] }, { "uniprot_ac": "Q80VQ0", "gene_name": "Aldh3b1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] } ] }, { "uniprot_ac": "Q8BWW9", "gene_name": "Pkn2", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8BWW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWW9" } ] } ] }, { "uniprot_ac": "Q8K045", "gene_name": "Pkn3", "activity": [ { "ec_number": "2.7.11.13", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] }, { "ec_number": "2.7.11.13", "activity": "", "evidence": [ { "id": "Q8K045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K045" } ] } ] }, { "uniprot_ac": "Q8K3K7", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9VGJ9", "gene_name": "Ho", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9VGJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGJ9" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "Q9VGJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGJ9" } ] } ] }, { "uniprot_ac": "Q9Z280", "gene_name": "Pld1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] } ] }, { "uniprot_ac": "Q9Z2A7", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }