{
    "uniprot_canonical_ac": "O55242-1",
    "uniprot_ac": "O55242",
    "uniprot_id": "SGMR1_MOUSE",
    "mass": {
        "chemical_mass": 25250.0,
        "monoisotopic_mass": 25250.0
    },
    "refseq": {
        "ac": "NP_001273467",
        "name": "sigma non-opioid intracellular receptor 1 isoform 2",
        "summary": "This gene encodes a transmembrane protein located in the endoplasmic reticulum. The encoded protein is a receptor that binds several endogenous ligands, including N,N-dimethyltryptamine, progesterone and pregnenolone and a variety of of non-opiate compounds. The encoded protein plays a role in regulating the activity of ion channels, acting as a chaperone and protecting cells from oxidative stress. In humans, this receptor has been associated with Alzheimer's and Parkinson's diseases, stroke and numerous disease conditions such as depression, pain and addiction. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2013].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
    },
    "gene_names": [
        {
            "name": "Sigmar1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O55242",
            "id": "O55242"
        },
        {
            "name": "Oprs1; Sig1R; sigma1R",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467",
            "id": "NP_001273467"
        },
        {
            "name": "Oprs1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O55242",
            "id": "O55242"
        },
        {
            "name": "Sigmar1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467",
            "id": "NP_001273467"
        }
    ],
    "protein_names": [
        {
            "name": "Sigma non-opioid intracellular receptor 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O55242"
        },
        {
            "name": "Sigma 1-type opioid receptor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O55242"
        },
        {
            "name": "Sigma1-receptor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O55242"
        },
        {
            "name": "Sigma1R",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O55242"
        },
        {
            "name": "sigma 1-type opioid receptor; sigma1-receptor; opioid receptor, sigma 1; sigma 1 receptor variant SR-1D",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467",
            "id": "NP_001273467"
        },
        {
            "name": "sigma non-opioid intracellular receptor 1 isoform 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467",
            "id": "NP_001273467"
        }
    ],
    "function": [
        {
            "annotation": "Data indicate that sigma1-receptor short form sigma(1)SR isoform interferes with sigma(1)R function relevant to mitochondrial energy production under endoplasmic reticulum stress conditions, promoting cellular apoptosis.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                },
                {
                    "database": "PubMed",
                    "id": "22619170",
                    "url": "https://glygen.org/publication/PubMed/22619170"
                }
            ]
        },
        {
            "annotation": "Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane (PubMed:12730355). Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration (PubMed:11149946, PubMed:14622179, PubMed:15571673, PubMed:15777781, PubMed:23332758, PubMed:9425306, PubMed:9603192). Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria (PubMed:25678561). Plays a role in protecting cells against oxidative stress-induced cell death via its interaction with RNF112 (PubMed:26792191).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242#function"
                },
                {
                    "database": "PubMed",
                    "id": "15777781",
                    "url": "https://glygen.org/publication/PubMed/15777781"
                },
                {
                    "database": "PubMed",
                    "id": "9425306",
                    "url": "https://glygen.org/publication/PubMed/9425306"
                },
                {
                    "database": "PubMed",
                    "id": "12730355",
                    "url": "https://glygen.org/publication/PubMed/12730355"
                },
                {
                    "database": "PubMed",
                    "id": "15571673",
                    "url": "https://glygen.org/publication/PubMed/15571673"
                },
                {
                    "database": "PubMed",
                    "id": "25678561",
                    "url": "https://glygen.org/publication/PubMed/25678561"
                },
                {
                    "database": "PubMed",
                    "id": "11149946",
                    "url": "https://glygen.org/publication/PubMed/11149946"
                },
                {
                    "database": "PubMed",
                    "id": "23332758",
                    "url": "https://glygen.org/publication/PubMed/23332758"
                },
                {
                    "database": "PubMed",
                    "id": "14622179",
                    "url": "https://glygen.org/publication/PubMed/14622179"
                },
                {
                    "database": "PubMed",
                    "id": "9603192",
                    "url": "https://glygen.org/publication/PubMed/9603192"
                },
                {
                    "database": "PubMed",
                    "id": "26792191",
                    "url": "https://glygen.org/publication/PubMed/26792191"
                }
            ]
        },
        {
            "annotation": "Genetic and Neuroimaging Analysis of SIGMAR1 for Frontotemporal Dementia.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                },
                {
                    "database": "PubMed",
                    "id": "37545231",
                    "url": "https://glygen.org/publication/PubMed/37545231"
                }
            ]
        },
        {
            "annotation": "Novel functions of the sigma-1 receptor",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                },
                {
                    "database": "PubMed",
                    "id": "22381068",
                    "url": "https://glygen.org/publication/PubMed/22381068"
                }
            ]
        },
        {
            "annotation": "Sigma-1 receptor expression in a subpopulation of lumbar spinal cord microglia in response to peripheral nerve injury. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                },
                {
                    "database": "PubMed",
                    "id": "37679500",
                    "url": "https://glygen.org/publication/PubMed/37679500"
                }
            ]
        },
        {
            "annotation": "The sigma-1 receptor may play a role in the regulation of motor behavior.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                },
                {
                    "database": "PubMed",
                    "id": "20167253",
                    "url": "https://glygen.org/publication/PubMed/20167253"
                }
            ]
        },
        {
            "annotation": "This gene encodes a transmembrane protein located in the endoplasmic reticulum. The encoded protein is a receptor that binds several endogenous ligands, including N,N-dimethyltryptamine, progesterone and pregnenolone and a variety of of non-opiate compounds. The encoded protein plays a role in regulating the activity of ion channels, acting as a chaperone and protecting cells from oxidative stress. In humans, this receptor has been associated with Alzheimer's and Parkinson's diseases, stroke and numerous disease conditions such as depression, pain and addiction. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2013].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0060207",
            "recommended_name": {
                "id": "DOID:0060207",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0060207",
                "name": "amyotrophic lateral sclerosis type 16",
                "description": "An amyotrophic lateral sclerosis that has_material_basis_in mutation in the SIGMAR1 gene (SETX) on chromosome 9."
            },
            "synonyms": [
                {
                    "id": "DOID:0060207",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060207",
                    "name": "ALS16",
                    "description": ""
                },
                {
                    "id": "DOID:0060207",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0060207",
                    "name": "amyotrophic lateral sclerosis 16",
                    "description": ""
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "amyotrophic lateral sclerosis type 16",
                    "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the SIGMAR1 gene."
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "ALS16",
                    "description": ""
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "SIGMAR1 amyotrophic lateral sclerosis",
                    "description": ""
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "amyotrophic lateral sclerosis 16",
                    "description": ""
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "amyotrophic lateral sclerosis caused by mutation in SIGMAR1",
                    "description": ""
                },
                {
                    "id": "MONDO:0013715",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0013715",
                    "name": "amyotrophic lateral sclerosis 16, juvenile",
                    "description": ""
                },
                {
                    "id": "MIM:614373",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/614373",
                    "name": "Amyotrophic lateral sclerosis 16, juvenile",
                    "description": "Amyotrophic lateral sclerosis 16, juvenile"
                }
            ],
            "evidence": [
                {
                    "id": "0060207",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0060207"
                }
            ]
        },
        {
            "disease_id": "DOID:0111065",
            "recommended_name": {
                "id": "DOID:0111065",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0111065",
                "name": "distal spinal muscular atrophy 2",
                "description": "A spinal muscular atrophy characterized by autosomal recessive inheritance of distal muscle weakness and muscle wasting primarily affecting the upper and lower limbswith onset typically in the first decade of life that has_material_basis_in homozygous mutation in the SIGMAR1 gene on chromosome 9p13."
            },
            "synonyms": [
                {
                    "id": "DOID:0111065",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111065",
                    "name": "DSMA2",
                    "description": ""
                },
                {
                    "id": "DOID:0111065",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111065",
                    "name": "dHMNJ",
                    "description": ""
                },
                {
                    "id": "DOID:0111065",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111065",
                    "name": "distal hereditary motor neuropathy Jerash type",
                    "description": ""
                },
                {
                    "id": "DOID:0111065",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111065",
                    "name": "spinal muscular atrophy Jerash type",
                    "description": ""
                },
                {
                    "id": "DOID:0111065",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111065",
                    "name": "autosomal recessive distal spinal muscular atrophy 2",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "autosomal recessive distal spinal muscular atrophy 2",
                    "description": "Distal hereditary motor neuropathy, Jerash type is a rare, genetic neuromuscular disease characterized by progressive, symmetrical, moderate to severe, distal muscle weakness and atrophy, without sensory involvement, first affecting the lower limbs (towards the end of the first decade) and then involving (within two years) the upper extremities. Patients typically develop foot drop, pes varus, hammer toes and claw hands. Pyramidal tract signs (e.g. brisk knee reflexes, positive Babinski sign, absent ankle reflexes) are initially associated but regress as disease stabilizes (~10 years after onset)."
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "DSMA2",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "autosomal recessive distal spinal muscular atrophy type 2",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "dHMNJ",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "distal hereditary motor neuropathy Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "spinal muscular atrophy Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "spinal muscular atrophy, distal, autosomal recessive, type 2",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "HMNJ",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "MNDJ",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "distal hereditary motor neuropathy, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "hereditary motor neuropathy, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "motor neuropathy, distal, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "neuronopathy, distal hereditary motor, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "neuropathy, distal hereditary motor, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "spinal muscular atrophy, Jerash type",
                    "description": ""
                },
                {
                    "id": "MONDO:0011585",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011585",
                    "name": "spinal muscular atrophy, distal, autosomal recessive, 2",
                    "description": ""
                },
                {
                    "id": "MIM:605726",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/605726",
                    "name": "Distal spinal muscular atrophy, autosomal recessive, 2",
                    "description": "Distal spinal muscular atrophy, autosomal recessive, 2"
                }
            ],
            "evidence": [
                {
                    "id": "0111065",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0111065"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Sigmar1",
            "url": "https://www.uniprot.org/uniprot/O55242",
            "locus": {
                "chromosome": "4",
                "start_pos": 41738493,
                "end_pos": 41756157,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000036078",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000036078"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000036078",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036078",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "CHEMBL3465",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3465",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "18391",
            "url": "https://www.ncbi.nlm.nih.gov/gene/18391",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "O55242",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:O55242*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR006716",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006716",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:18391",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18391",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1195268",
            "url": "http://www.informatics.jax.org/marker/MGI:1195268",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "AMYVIHA",
            "url": "https://omabrowser.org/oma/group/AMYVIHA/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "168990at2759",
            "url": "http://www.orthodb.org/?query=168990at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10868",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10868",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10868:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10868:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF04622",
            "url": "http://pfam.xfam.org/family/PF04622",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_O55242",
            "url": "http://purl.obolibrary.org/obo/PR_O55242",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001273467",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O55242",
            "url": "https://www.uniprot.org/uniprot/O55242",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O55242-1",
            "url": "https://www.uniprot.org/uniprot/O55242-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O55242-2",
            "url": "https://www.uniprot.org/uniprot/O55242-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS",
        "length": 223,
        "header": "sp|O55242-1|SGMR1_MOUSE Isoform 1 of Sigma non-opioid intracellular receptor 1  OS=Mus musculus OX=10090 GN=Sigmar1 PE=1 SV=1 CANONICAL=O55242-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O55242-1",
            "url": "",
            "sequence": {
                "sequence": "MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS",
                "length": 223,
                "header": "sp|O55242-1|SGMR1_MOUSE Isoform 1 of Sigma non-opioid intracellular receptor 1  OS=Mus musculus OX=10090 GN=Sigmar1 PE=1 SV=1 CANONICAL=O55242-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 41741252,
                "end_pos": 41739357,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000059354",
                        "url": "https://www.ensembl.org/id/ENSMUST00000059354"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000056027",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000056027"
                    }
                ]
            }
        },
        {
            "isoform_ac": "O55242-2",
            "url": "",
            "sequence": {
                "sequence": "MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS",
                "length": 192,
                "header": "sp|O55242-2|SGMR1_MOUSE Isoform 2 of Sigma non-opioid intracellular receptor 1  OS=Mus musculus OX=10090 GN=Sigmar1 PE=1 SV=1 CANONICAL=O55242-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 41741252,
                "end_pos": 41739357,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000071561",
                        "url": "https://www.ensembl.org/id/ENSMUST00000071561"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000071492",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000071492"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Regulating ankyrin dynamics: roles of sigma-1 receptors.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2001",
            "authors": "Hayashi T., Su T.-P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11149946",
                    "url": "https://glygen.org/publication/PubMed/11149946"
                }
            ]
        },
        {
            "title": "Expression of the purported sigma(1) (sigma(1)) receptor in the mammalian brain and its possible relevance in deficits induced by antagonism of the NMDA receptor complex as revealed using an antisense strategy.",
            "journal": "J. Chem. Neuroanat.",
            "date": "2000",
            "authors": "Quirion R., Glossmann H., Moebius F.F., Kitaichi K., Chabot J.-G., Flandorfer A.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11207432",
                    "url": "https://glygen.org/publication/PubMed/11207432"
                }
            ]
        },
        {
            "title": "Expression pattern of the type 1 sigma receptor in the brain and identity of critical anionic amino acid residues in the ligand-binding domain of the receptor.",
            "journal": "Biochim. Biophys. Acta",
            "date": "2001",
            "authors": "Seth P, Ganapathy ME, Conway SJ, Bridges CD, Smith SB, Casellas P, Ganapathy V",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11476895",
                    "url": "https://glygen.org/publication/PubMed/11476895"
                }
            ]
        },
        {
            "title": "Expression pattern of sigma receptor 1 mRNA and protein in mammalian retina.",
            "journal": "Brain Res. Mol. Brain Res.",
            "date": "2001",
            "authors": "Ganapathy V., Moore P., Casellas P., Agarwal N., Smith S.B., Roon P., El-Sherbeny A., Ola M.S., Sarthy V.P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11687279",
                    "url": "https://glygen.org/publication/PubMed/11687279"
                }
            ]
        },
        {
            "title": "Sigma-1 receptors (sigma(1) binding sites) form raft-like microdomains and target lipid droplets on the endoplasmic reticulum: roles in endoplasmic reticulum lipid compartmentalization and export.",
            "journal": "J. Pharmacol. Exp. Ther.",
            "date": "2003",
            "authors": "Hayashi T., Su T.-P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12730355",
                    "url": "https://glygen.org/publication/PubMed/12730355"
                }
            ]
        },
        {
            "title": "Generation and phenotypic analysis of sigma receptor type I (sigma 1) knockout mice.",
            "journal": "Eur. J. Neurosci.",
            "date": "2003",
            "authors": "Perez R., Tovar V., Langa F., Hernandez E., Zamanillo D., Cantero M., Codony X., Cozar P., Dordal A., Gimenez E., Guitart X., Lavado A., Monroy X., Montoliu L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14622179",
                    "url": "https://glygen.org/publication/PubMed/14622179"
                }
            ]
        },
        {
            "title": "Involvement of kappa-opioid receptors and sigma receptors in memory function demonstrated using an antisense strategy.",
            "journal": "Brain Res.",
            "date": "2004",
            "authors": "Hoshino T., Hiramatsu M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15571673",
                    "url": "https://glygen.org/publication/PubMed/15571673"
                }
            ]
        },
        {
            "title": "Formalin-induced pain is reduced in sigma(1) receptor knockout mice.",
            "journal": "Eur. J. Pharmacol.",
            "date": "2005",
            "authors": "Baeyens J.M., Cendan C.M., Montoliu L., Portillo-Salido E., Pujalte J.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15777781",
                    "url": "https://glygen.org/publication/PubMed/15777781"
                }
            ]
        },
        {
            "title": "The sigma-1 receptor is enriched in postsynaptic sites of C-terminals in mouse motoneurons. An anatomical and behavioral study.",
            "journal": "Neuroscience",
            "date": "2010",
            "authors": "Mavlyutov TA, Epstein ML, Andersen KA, Ziskind-Conhaim L, Ruoho AE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20167253",
                    "url": "https://glygen.org/publication/PubMed/20167253"
                }
            ]
        },
        {
            "title": "The sigma-1 receptor protects against cellular oxidative stress and activates antioxidant response elements.",
            "journal": "European journal of pharmacology",
            "date": "2012",
            "authors": "Pal A, Fontanilla D, Gopalakrishnan A, Chae YK, Markley JL, Ruoho AE",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22381068",
                    "url": "https://glygen.org/publication/PubMed/22381068"
                }
            ]
        },
        {
            "title": "Expression of a truncated form of the endoplasmic reticulum chaperone protein, sigma1 receptor, promotes mitochondrial energy depletion and apoptosis.",
            "journal": "The Journal of biological chemistry",
            "date": "2012",
            "authors": "Shioda N, Ishikawa K, Tagashira H, Ishizuka T, Yawo H, Fukunaga K",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22619170",
                    "url": "https://glygen.org/publication/PubMed/22619170"
                }
            ]
        },
        {
            "title": "Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine.",
            "journal": "Cell",
            "date": "2013",
            "authors": "Hayashi T., Tsai S.Y., Bonci A., Chuang J.Y., Kourrich S., Su T.P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23332758",
                    "url": "https://glygen.org/publication/PubMed/23332758"
                }
            ]
        },
        {
            "title": "Dysfunction in endoplasmic reticulum-mitochondria crosstalk underlies SIGMAR1 loss of function mediated motor neuron degeneration.",
            "journal": "Brain",
            "date": "2015",
            "authors": "Chrast R., Azzedine H., Medard J.J., Bernard-Marissal N.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25678561",
                    "url": "https://glygen.org/publication/PubMed/25678561"
                }
            ]
        },
        {
            "title": "The sigma-1 receptor-zinc finger protein 179 pathway protects against hydrogen peroxide-induced cell injury.",
            "journal": "Neuropharmacology",
            "date": "2016",
            "authors": "Su TC, Lin SH, Lee PT, Yeh SH, Hsieh TH, Chou SY, Su TP, Hung JJ, Chang WC, Lee YC, Chuang JY",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26792191",
                    "url": "https://glygen.org/publication/PubMed/26792191"
                }
            ]
        },
        {
            "title": "Genetic and Neuroimaging Analysis of SIGMAR1 for Frontotemporal Dementia.",
            "journal": "Journal of Alzheimer's disease : JAD",
            "date": "2023",
            "authors": "Che Xiang-Qian, Lin Guo-Zhen, Liu Xiao-Hong, Wang Gang, Zhao Qian-Hua, Ren Ru-Jing",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37545231",
                    "url": "https://glygen.org/publication/PubMed/37545231"
                }
            ]
        },
        {
            "title": "Sigma-1 receptor expression in a subpopulation of lumbar spinal cord microglia in response to peripheral nerve injury.",
            "journal": "Scientific reports",
            "date": "2023-09-07",
            "authors": "Schonfeld Ethan, Johnstone Thomas Michael, Haider Ghani, Shah Aaryan, Marianayagam Neelan Joseph, Biswal Sandip, Veeravagu Anand",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001273467",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273467"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37679500",
                    "url": "https://glygen.org/publication/PubMed/37679500"
                }
            ]
        },
        {
            "title": "Cloning and structural analysis of the cDNA and the gene encoding the murine type 1 sigma receptor.",
            "journal": "Biochem. Biophys. Res. Commun.",
            "date": "1997",
            "authors": "Seth P, Leibach FH, Ganapathy V",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9425306",
                    "url": "https://glygen.org/publication/PubMed/9425306"
                }
            ]
        },
        {
            "title": "Cloning and characterization of a mouse sigma1 receptor.",
            "journal": "J. Neurochem.",
            "date": "1998",
            "authors": "Pan YX, Mei J, Xu J, Wan BL, Zuckerman A, Pasternak GW",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55242",
                    "url": "https://www.uniprot.org/uniprot/O55242"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9603192",
                    "url": "https://glygen.org/publication/PubMed/9603192"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:18391",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18391",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q99720-1",
            "protein_name": "Sigma non-opioid intracellular receptor 1",
            "gene_name": "SIGMAR1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP",
                "length": 223
            },
            "evidence": [
                {
                    "id": "45232029",
                    "url": "http://www.informatics.jax.org/homology/45232029",
                    "database": "MGI"
                },
                {
                    "id": "O55242",
                    "url": "https://omabrowser.org/oma/group/O55242/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9R0C9-1",
            "protein_name": "Sigma non-opioid intracellular receptor 1",
            "gene_name": "Sigmar1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP",
                "length": 223
            },
            "evidence": [
                {
                    "id": "45232029",
                    "url": "http://www.informatics.jax.org/homology/45232029",
                    "database": "MGI"
                },
                {
                    "id": "O55242",
                    "url": "https://omabrowser.org/oma/group/O55242/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled opioid receptor activity",
                        "id": "GO:0004985",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004985",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "identical protein binding",
                        "id": "GO:0042802",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signaling receptor activity",
                        "id": "GO:0038023",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 12,
                "go_terms": [
                    {
                        "name": "nuclear envelope",
                        "id": "GO:0005635",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endoplasmic reticulum",
                        "id": "GO:0005783",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lipid droplet",
                        "id": "GO:0005811",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "postsynaptic density",
                        "id": "GO:0014069",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014069",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "growth cone",
                        "id": "GO:0030426",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endoplasmic reticulum membrane",
                        "id": "GO:0005789",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasmic vesicle",
                        "id": "GO:0031410",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear inner membrane",
                        "id": "GO:0005637",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005637",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear outer membrane",
                        "id": "GO:0005640",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005640",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "postsynaptic density membrane",
                        "id": "GO:0098839",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098839",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "anchoring junction",
                        "id": "GO:0070161",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070161",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "lipid transport",
                        "id": "GO:0006869",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nervous system development",
                        "id": "GO:0007399",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein homotrimerization",
                        "id": "GO:0070207",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070207",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of neuron apoptotic process",
                        "id": "GO:0043523",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043523",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55242",
                                "url": "https://www.uniprot.org/uniprot/O55242"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 18
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}