{
    "uniprot_canonical_ac": "O55197-1",
    "uniprot_ac": "O55197",
    "uniprot_id": "C3AR_RAT",
    "mass": {
        "chemical_mass": 52896.0,
        "monoisotopic_mass": 52896.0
    },
    "refseq": {
        "ac": "NP_114449",
        "name": "C3a anaphylatoxin chemotactic receptor",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
    },
    "gene_names": [
        {
            "name": "C3ar1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O55197",
            "id": "O55197"
        },
        {
            "name": "C3ar1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449",
            "id": "NP_114449"
        }
    ],
    "protein_names": [
        {
            "name": "C3a anaphylatoxin chemotactic receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O55197"
        },
        {
            "name": "C3AR; C3a-R; complement component 3a receptor 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449",
            "id": "NP_114449"
        },
        {
            "name": "C3AR",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O55197"
        },
        {
            "name": "C3a anaphylatoxin chemotactic receptor isoform X1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006237376",
            "id": "XP_006237376"
        },
        {
            "name": "C3a anaphylatoxin chemotactic receptor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449",
            "id": "NP_114449"
        },
        {
            "name": "C3a-R",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O55197"
        }
    ],
    "function": [
        {
            "annotation": "C3aR in astrocytes mediates post-thoracotomy pain by inducing A1 astrocytes in male rats.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                },
                {
                    "database": "PubMed",
                    "id": "36871753",
                    "url": "https://glygen.org/publication/PubMed/36871753"
                }
            ]
        },
        {
            "annotation": "C3aRA ameliorated T2DN by inhibiting IKBalpha phosphorylation and cytokine release, and also TGF-beta/Smad3 signaling and ECM deposition Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                },
                {
                    "database": "PubMed",
                    "id": "25422985",
                    "url": "https://glygen.org/publication/PubMed/25422985"
                }
            ]
        },
        {
            "annotation": "Inhibition of C3a/C3aR Axis in Diverse Stages of Ulcerative Colitis Affected the Prognosis of UC by Modulating the Pyroptosis and Expression of Caspase-11. Erratum:[Inflammation. 2021 Jun;44(3):1203-1204. PMID: 33174140]",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                },
                {
                    "database": "PubMed",
                    "id": "32617860",
                    "url": "https://glygen.org/publication/PubMed/32617860"
                }
            ]
        },
        {
            "annotation": "Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "G3V759",
                    "url": "https://www.uniprot.org/uniprot/G3V759#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "ARBA00025640",
                    "url": "https://www.uniprot.org/uniprot/ARBA00025640#function"
                }
            ]
        },
        {
            "annotation": "The C3 and C3a receptor system may primarily be involved in the pathogenesis of renal remodeling in hypertensive rats.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                },
                {
                    "database": "PubMed",
                    "id": "23713944",
                    "url": "https://glygen.org/publication/PubMed/23713944"
                }
            ]
        },
        {
            "annotation": "The binding of TLQP-21 to C3AR1 not only has effects on signaling but also modulates cellular functions",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                },
                {
                    "database": "PubMed",
                    "id": "23940034",
                    "url": "https://glygen.org/publication/PubMed/23940034"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:11394",
            "recommended_name": {
                "id": "DOID:11394",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:11394",
                "name": "adult respiratory distress syndrome",
                "description": "A respiratory failure that results from diffuse injury to the endothelium of the lung (as in sepsis, chest trauma, massive blood transfusion, aspiration of the gastric contents, or pneumonia) and is characterized by pulmonary edema with an abnormally high amount of protein in the edematous fluid and by difficult rapid breathing and hypoxemia."
            },
            "synonyms": [
                {
                    "id": "DOID:11394",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11394",
                    "name": "ARDS",
                    "description": ""
                },
                {
                    "id": "DOID:11394",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11394",
                    "name": "Non-cardiogenic pulmonary edema",
                    "description": ""
                },
                {
                    "id": "DOID:11394",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11394",
                    "name": "Shock lung",
                    "description": ""
                },
                {
                    "id": "DOID:11394",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11394",
                    "name": "adult RDS",
                    "description": ""
                },
                {
                    "id": "DOID:11394",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:11394",
                    "name": "acute respiratory distress syndrome",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "11394",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:11394"
                }
            ]
        },
        {
            "disease_id": "DOID:2841",
            "recommended_name": {
                "id": "DOID:2841",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:2841",
                "name": "asthma",
                "description": "A bronchial disease that is characterized by chronic inflammation and narrowing of the airways, which is caused by a combination of environmental and genetic factors. The disease has_symptom recurring periods of wheezing (a whistling sound while breathing), has_symptom chest tightness, has_symptom shortness of breath, has_symptom mucus production and has_symptom coughing."
            },
            "synonyms": [
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "Exercise induced asthma",
                    "description": ""
                },
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "bronchial hyperreactivity",
                    "description": ""
                },
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "chronic obstructive asthma",
                    "description": ""
                },
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "chronic obstructive asthma with acute exacerbation",
                    "description": ""
                },
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "chronic obstructive asthma with status asthmaticus",
                    "description": ""
                },
                {
                    "id": "DOID:2841",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:2841",
                    "name": "exercise-induced asthma",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "inherited susceptibility to asthma",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma, nocturnal, susceptibility to",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma, bronchial",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma, diminished response to Antileukotriene treatment 1N",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma, protection against",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma, susceptibility to",
                    "description": ""
                },
                {
                    "id": "MONDO:0010940",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010940",
                    "name": "asthma-related traits, susceptibility to",
                    "description": ""
                },
                {
                    "id": "MIM:600807",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/600807",
                    "name": "Asthma",
                    "description": "Asthma"
                }
            ],
            "evidence": [
                {
                    "id": "2841",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:2841"
                }
            ]
        },
        {
            "disease_id": "DOID:4483",
            "recommended_name": {
                "id": "DOID:4483",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:4483",
                "name": "rhinitis",
                "description": "A upper respiratory infectious disease which involves irritation and inflammation of the mucous membrane of the nose due to viruses, bacteria or irritants. The inflammation results in generation of excessive amounts of mucus leading to runny nose, as well as nasal congestion and post-nasal drip."
            },
            "synonyms": [],
            "evidence": [
                {
                    "id": "4483",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:4483"
                }
            ]
        },
        {
            "disease_id": "DOID:850",
            "recommended_name": {
                "id": "DOID:850",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:850",
                "name": "lung disease",
                "description": "A lower respiratory tract disease in which the function of the lungs is adversely affected by narrowing or blockage of the airways resulting in poor air flow, a loss of elasticity in the lungs that produces a decrease in the total volume of air that the lungs are able to hold, and clotting, scarring, or inflammation of the blood vessels that affect the ability of the lungs to take up oxygen and to release carbon dioxide."
            },
            "synonyms": [],
            "evidence": [
                {
                    "id": "850",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:850"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "C3ar1",
            "url": "https://www.uniprot.org/uniprot/O55197",
            "locus": {
                "chromosome": "4",
                "start_pos": 156075389,
                "end_pos": 156084701,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000009211",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000009211"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSRNOG00000009211",
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000009211",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "84007",
            "url": "https://www.ncbi.nlm.nih.gov/gene/84007",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000826",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000826",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001644",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001644",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR002234",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002234",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:84007",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:84007",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "MKPVWCQ",
            "url": "https://omabrowser.org/oma/group/MKPVWCQ/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5356571at2759",
            "url": "http://www.orthodb.org/?query=5356571at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24225",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24225",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24225:SF28",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24225:SF28",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00001",
            "url": "http://pfam.xfam.org/family/PF00001",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_O55197",
            "url": "http://purl.obolibrary.org/obo/PR_O55197",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-RNO-375276",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-RNO-418594",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-RNO-6798695",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-RNO-977606",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-977606",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_114449",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "620537",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620537",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "G3V759",
            "url": "https://www.uniprot.org/uniprot/G3V759",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "G3V759-1",
            "url": "https://www.uniprot.org/uniprot/G3V759-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O55197",
            "url": "https://www.uniprot.org/uniprot/O55197",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O55197-1",
            "url": "https://www.uniprot.org/uniprot/O55197-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVWFLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDRCLMVHKPIWCQNHRSVRTAFAVCGCVWVVTFVMCIPVFVYRDLLVVDDYSVCGYNFDSSRAYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSSVPARDLWTATTALQSQTFHTSPEDPFSQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLYAHDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKSRNKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFNPFLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV",
        "length": 473,
        "header": "sp|O55197-1|C3AR_RAT Isoform 1 of C3a anaphylatoxin chemotactic receptor  OS=Rattus norvegicus OX=10116 GN=C3ar1 PE=1 SV=1 CANONICAL=O55197-1"
    },
    "isoforms": [
        {
            "isoform_ac": "G3V759-1",
            "url": "",
            "sequence": {
                "sequence": "MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVWFLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDRCLMVHKPIWCQNHRSVRTAFAVCGCVWVVAFVMCIPVFVYRDLLVVDDYSVCGYNFDSSRAYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSVPARDLWTATTALQSQTFHTSPEDPFSQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLYAHDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKSRNKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFNPFLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV",
                "length": 472,
                "header": "tr|G3V759-1|G3V759_RAT Computationally mapped isoform of C3a anaphylatoxin chemotactic receptor  OS=Rattus norvegicus OX=10116 GN=C3ar1 PE=3 SV=1 CANONICAL=O55197-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 156079653,
                "end_pos": 156078238,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000012216.4",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000012216.4"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000012216.2",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000012216.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "O55197-1",
            "url": "",
            "sequence": {
                "sequence": "MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVWFLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDRCLMVHKPIWCQNHRSVRTAFAVCGCVWVVTFVMCIPVFVYRDLLVVDDYSVCGYNFDSSRAYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSSVPARDLWTATTALQSQTFHTSPEDPFSQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLYAHDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKSRNKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFNPFLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV",
                "length": 473,
                "header": "sp|O55197-1|C3AR_RAT Isoform 1 of C3a anaphylatoxin chemotactic receptor  OS=Rattus norvegicus OX=10116 GN=C3ar1 PE=1 SV=1 CANONICAL=O55197-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 201,
            "start_aa": "Asn",
            "end_pos": 201,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn201",
            "evidence": [
                {
                    "id": "O55197",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/O55197#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 9,
            "start_aa": "Asn",
            "end_pos": 9,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn9",
            "evidence": [
                {
                    "id": "O55197",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/O55197#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 448,
            "end_pos": 448,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197"
                }
            ],
            "site_lbl": "Ser448"
        },
        {
            "start_pos": 452,
            "end_pos": 452,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197"
                }
            ],
            "site_lbl": "Thr452"
        }
    ],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Role of complement 3a in the growth of mesangial cells from stroke-prone spontaneously hypertensive rats.",
            "journal": "Clinical and experimental hypertension (New York, N.Y. : 1993)",
            "date": "2014",
            "authors": "Ikeda K, Fukuda N, Ueno T, Endo M, Kobayashi N, Soma M, Matsumoto K",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23713944",
                    "url": "https://glygen.org/publication/PubMed/23713944"
                }
            ]
        },
        {
            "title": "Identification of the C3a receptor (C3AR1) as the target of the VGF-derived peptide TLQP-21 in rodent cells.",
            "journal": "J. Biol. Chem.",
            "date": "2013",
            "authors": "Hannedouche S, Beck V, Leighton-Davies J, Beibel M, Roma G, Oakeley EJ, Lannoy V, Bernard J, Hamon J, Barbieri S, Preuss I, Lasbennes MC, Sailer AW, Suply T, Seuwen K, Parker CN, Bassilana F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23940034",
                    "url": "https://glygen.org/publication/PubMed/23940034"
                }
            ]
        },
        {
            "title": "C3a receptor antagonist ameliorates inflammatory and fibrotic signals in type 2 diabetic nephropathy by suppressing the activation of TGF-beta/smad3 and IKBalpha pathway.",
            "journal": "PloS one",
            "date": "2014",
            "authors": "Li L, Yin Q, Tang X, Bai L, Zhang J, Gou S, Zhu H, Cheng J, Fu P, Liu F",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25422985",
                    "url": "https://glygen.org/publication/PubMed/25422985"
                }
            ]
        },
        {
            "title": "Inhibition of C3a/C3aR Axis in Diverse Stages of Ulcerative Colitis Affected the Prognosis of UC by Modulating the Pyroptosis and Expression of Caspase-11.",
            "journal": "Inflammation",
            "date": "2020",
            "authors": "Zhang X, Chen Y, Yu S, Jin B, Liu W",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32617860",
                    "url": "https://glygen.org/publication/PubMed/32617860"
                }
            ]
        },
        {
            "title": "C3aR in astrocytes mediates post-thoracotomy pain by inducing A1 astrocytes in male rats.",
            "journal": "Biochimica et biophysica acta. Molecular basis of disease",
            "date": "2023",
            "authors": "Zhu A, Cui H, Su W, Liu C, Yu X, Huang Y",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_114449",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_114449"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36871753",
                    "url": "https://glygen.org/publication/PubMed/36871753"
                }
            ]
        },
        {
            "title": "Cloning and characterization of rat C3a receptor: differential expression of rat C3a and C5a receptors by LPS stimulation.",
            "journal": "Biochem. Biophys. Res. Commun.",
            "date": "1998",
            "authors": "Fukuoka Y, Ember JA, Hugli TE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O55197",
                    "url": "https://www.uniprot.org/uniprot/O55197"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9464274",
                    "url": "https://glygen.org/publication/PubMed/9464274"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:84007",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:84007",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-RNO-375276",
            "name": "Peptide ligand-binding receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276",
            "resource": "Reactome",
            "description": "Peptide ligand-binding receptors"
        },
        {
            "id": "R-RNO-418594",
            "name": "G alpha (i) signalling events",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594",
            "resource": "Reactome",
            "description": "G alpha (i) signalling events"
        },
        {
            "id": "R-RNO-6798695",
            "name": "Neutrophil degranulation",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695",
            "resource": "Reactome",
            "description": "Neutrophil degranulation"
        },
        {
            "id": "R-RNO-977606",
            "name": "Regulation of Complement cascade",
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-977606",
            "resource": "Reactome",
            "description": "Regulation of Complement cascade"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O09047-1",
            "protein_name": "C3a anaphylatoxin chemotactic receptor",
            "gene_name": "C3ar1",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MESFDADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVWFLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDRCLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSRSYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTSPEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASSGHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTNFTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASANSCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV",
                "length": 477
            },
            "evidence": [
                {
                    "id": "45240590",
                    "url": "http://www.informatics.jax.org/homology/45240590",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q16581-1",
            "protein_name": "C3a anaphylatoxin chemotactic receptor",
            "gene_name": "C3AR1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV",
                "length": 482
            },
            "evidence": [
                {
                    "id": "45240590",
                    "url": "http://www.informatics.jax.org/homology/45240590",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 16,
                "go_terms": [
                    {
                        "name": "positive regulation of glomerular mesangial cell proliferation",
                        "id": "GO:0072126",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072126",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "complement receptor mediated signaling pathway",
                        "id": "GO:0002430",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002430",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "chemotaxis",
                        "id": "GO:0006935",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "inflammatory response",
                        "id": "GO:0006954",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cytosolic calcium ion concentration",
                        "id": "GO:0007204",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell migration",
                        "id": "GO:0030335",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of blood pressure",
                        "id": "GO:0008217",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008217",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of vascular endothelial growth factor production",
                        "id": "GO:0010575",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010575",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of angiogenesis",
                        "id": "GO:0045766",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of smooth muscle cell proliferation",
                        "id": "GO:0048661",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "phospholipase C-activating G protein-coupled receptor signaling pathway",
                        "id": "GO:0007200",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007200",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway",
                        "id": "GO:0051482",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051482",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of DNA biosynthetic process",
                        "id": "GO:2000573",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of neutrophil chemotaxis",
                        "id": "GO:0090023",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090023",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of macrophage chemotaxis",
                        "id": "GO:0010759",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010759",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "tolerance induction to nonself antigen",
                        "id": "GO:0002462",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002462",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "complement component C3a binding",
                        "id": "GO:0001850",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001850",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "complement component C3a receptor activity",
                        "id": "GO:0004876",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004876",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "complement component C5a receptor activity",
                        "id": "GO:0004878",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004878",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O55197",
                                "url": "https://www.uniprot.org/uniprot/O55197"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 201,
            "end_pos": 203,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 356,
            "end_pos": 358,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 362,
            "end_pos": 364,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 9,
            "end_pos": 11,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 6
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}