{
    "uniprot_canonical_ac": "O54915-1",
    "uniprot_ac": "O54915",
    "uniprot_id": "NR1I2_MOUSE",
    "mass": {
        "chemical_mass": 49567.0,
        "monoisotopic_mass": 49567.0
    },
    "refseq": {
        "ac": "NP_001091874",
        "name": "nuclear receptor subfamily 1 group I member 2 isoform 2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
    },
    "gene_names": [
        {
            "name": "Nr1i2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O54915",
            "id": "O54915"
        },
        {
            "name": "Nr1i2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874",
            "id": "NP_001091874"
        },
        {
            "name": "Pxr",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O54915",
            "id": "O54915"
        },
        {
            "name": "mPXR; PXR; PXR.1; PXR.2; PXR1; SXR",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874",
            "id": "NP_001091874"
        }
    ],
    "protein_names": [
        {
            "name": "Nuclear receptor subfamily 1 group I member 2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O54915"
        },
        {
            "name": "Orphan nuclear receptor PXR",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O54915"
        },
        {
            "name": "Pregnane X receptor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O54915"
        },
        {
            "name": "nuclear receptor subfamily 1 group I member 2 isoform 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874",
            "id": "NP_001091874"
        },
        {
            "name": "orphan nuclear receptor PXR; Pregnane X receptor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874",
            "id": "NP_001091874"
        }
    ],
    "function": [
        {
            "annotation": "Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand-binding domain. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity). Activated by naturally occurring steroids such as pregnenolone and progesterone, the cholesterol metabolite 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol, synthetic glucocorticoids and antiglucocorticoids and 16-alpha-carbonitrile (PCN).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915#function"
                },
                {
                    "database": "PubMed",
                    "id": "12569201",
                    "url": "https://glygen.org/publication/PubMed/12569201"
                },
                {
                    "database": "PubMed",
                    "id": "19297428",
                    "url": "https://glygen.org/publication/PubMed/19297428"
                }
            ]
        },
        {
            "annotation": "Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                },
                {
                    "database": "PubMed",
                    "id": "36720308",
                    "url": "https://glygen.org/publication/PubMed/36720308"
                }
            ]
        },
        {
            "annotation": "PXR triggers YAP-TEAD binding and Sirt2-driven YAP deacetylation and polyubiquitination to promote liver enlargement and regeneration in mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                },
                {
                    "database": "PubMed",
                    "id": "36657504",
                    "url": "https://glygen.org/publication/PubMed/36657504"
                }
            ]
        },
        {
            "annotation": "Pregnane X receptor activation remodels glucose metabolism to promote NAFLD development in obese mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                },
                {
                    "database": "PubMed",
                    "id": "37467962",
                    "url": "https://glygen.org/publication/PubMed/37467962"
                }
            ]
        },
        {
            "annotation": "Pregnane X receptor promotes liver enlargement in mice through the spatial induction of hepatocyte hypertrophy and proliferation.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                },
                {
                    "database": "PubMed",
                    "id": "36030841",
                    "url": "https://glygen.org/publication/PubMed/36030841"
                }
            ]
        },
        {
            "annotation": "The Pregnane X Receptor and Indole-3-Propionic Acid Shape the Intestinal Mesenchyme to Restrain Inflammation and Fibrosis.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                },
                {
                    "database": "PubMed",
                    "id": "36309199",
                    "url": "https://glygen.org/publication/PubMed/36309199"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:13580",
            "recommended_name": {
                "id": "DOID:13580",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:13580",
                "name": "cholestasis",
                "description": "A bile duct disease that is characterized by where bile cannot flow from the liver to the duodenum."
            },
            "synonyms": [
                {
                    "id": "DOID:13580",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:13580",
                    "name": "Obstruction of bile duct",
                    "description": ""
                },
                {
                    "id": "DOID:13580",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:13580",
                    "name": "bile occlusion",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "13580",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:13580"
                }
            ]
        },
        {
            "disease_id": "DOID:1826",
            "recommended_name": {
                "id": "DOID:1826",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:1826",
                "name": "epilepsy",
                "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions."
            },
            "synonyms": [
                {
                    "id": "DOID:1826",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:1826",
                    "name": "epilepsy syndrome",
                    "description": ""
                },
                {
                    "id": "DOID:1826",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:1826",
                    "name": "epileptic syndrome",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "1826",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:1826"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Nr1i2",
            "url": "https://www.uniprot.org/uniprot/O54915",
            "locus": {
                "chromosome": "16",
                "start_pos": 38068685,
                "end_pos": 38115186,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000022809",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000022809"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000022809",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022809",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "CHEMBL1743244",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743244",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "18171",
            "url": "https://www.ncbi.nlm.nih.gov/gene/18171",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "O54915",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:O54915*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000536",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000536",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001628",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001628",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001723",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001723",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013088",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013088",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR035500",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR035500",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:18171",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18171",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1337040",
            "url": "http://www.informatics.jax.org/marker/MGI:1337040",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "GTCEITQ",
            "url": "https://omabrowser.org/oma/group/GTCEITQ/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5359733at2759",
            "url": "http://www.orthodb.org/?query=5359733at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24082",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24082",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24082:SF39",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24082:SF39",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00104",
            "url": "http://pfam.xfam.org/family/PF00104",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00105",
            "url": "http://pfam.xfam.org/family/PF00105",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_O54915",
            "url": "http://purl.obolibrary.org/obo/PR_O54915",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-383280",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-383280",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-MMU-4090294",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4090294",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001091874",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O54915",
            "url": "https://www.uniprot.org/uniprot/O54915",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O54915-1",
            "url": "https://www.uniprot.org/uniprot/O54915-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O54915-2",
            "url": "https://www.uniprot.org/uniprot/O54915-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCELPEFLQASLLEDPATWSQIMKDRVPMKISLQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG",
        "length": 431,
        "header": "sp|O54915-1|NR1I2_MOUSE Isoform 1 of Nuclear receptor subfamily 1 group I member 2  OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1 CANONICAL=O54915-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O54915-1",
            "url": "",
            "sequence": {
                "sequence": "MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCELPEFLQASLLEDPATWSQIMKDRVPMKISLQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG",
                "length": 431,
                "header": "sp|O54915-1|NR1I2_MOUSE Isoform 1 of Nuclear receptor subfamily 1 group I member 2  OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1 CANONICAL=O54915-1"
            },
            "locus": {
                "chromosome": "16",
                "start_pos": 38086463,
                "end_pos": 38069610,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000023504",
                        "url": "https://www.ensembl.org/id/ENSMUST00000023504"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000023504",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000023504"
                    }
                ]
            }
        },
        {
            "isoform_ac": "O54915-2",
            "url": "",
            "sequence": {
                "sequence": "MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG",
                "length": 390,
                "header": "sp|O54915-2|NR1I2_MOUSE Isoform 2 of Nuclear receptor subfamily 1 group I member 2  OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1 CANONICAL=O54915-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Identification of an endogenous ligand that activates pregnane X receptor-mediated sterol clearance.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2003",
            "authors": "Lin M., Salen G., Fan M., Batta A.K., Wang E., Dussault I., Erickson S.K., Forman B.M., Yoo H.-D.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12569201",
                    "url": "https://glygen.org/publication/PubMed/12569201"
                }
            ]
        },
        {
            "title": "Molecular mechanism of nuclear translocation of an orphan nuclear receptor, SXR.",
            "journal": "Mol. Pharmacol.",
            "date": "2003",
            "authors": "Kawana K, Ikuta T, Kobayashi Y, Gotoh O, Takeda K, Kawajiri K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12606758",
                    "url": "https://glygen.org/publication/PubMed/12606758"
                }
            ]
        },
        {
            "title": "Human CYP3A4 and murine Cyp3A11 are regulated by equol and genistein via the pregnane X receptor in a species-specific manner.",
            "journal": "J. Nutr.",
            "date": "2009",
            "authors": "Li Y., Ricketts M.L., Moore D.D., Ross-Viola J.S., Shay N.F.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19297428",
                    "url": "https://glygen.org/publication/PubMed/19297428"
                }
            ]
        },
        {
            "title": "Circadian repressors CRY1 and CRY2 broadly interact with nuclear receptors and modulate transcriptional activity.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2017",
            "authors": "Kriebs A, Jordan SD, Soto E, Henriksson E, Sandate CR, Vaughan ME, Chan AB, Duglan D, Papp SJ, Huber AL, Afetian ME, Yu RT, Zhao X, Downes M, Evans RM, Lamia KA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28751364",
                    "url": "https://glygen.org/publication/PubMed/28751364"
                }
            ]
        },
        {
            "title": "Pregnane X receptor promotes liver enlargement in mice through the spatial induction of hepatocyte hypertrophy and proliferation.",
            "journal": "Chemico-biological interactions",
            "date": "2022-11-01",
            "authors": "Tian Jianing, Wang Ruimin, Yang Xiao, Yang Jie, Zhang Yifei, Li Xuan, Liang Hangfei, Fan Shicheng, Gao Yue, Zhang Simin, Qu Xiangyang, Huang Min, Bi Huichang",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36030841",
                    "url": "https://glygen.org/publication/PubMed/36030841"
                }
            ]
        },
        {
            "title": "The Pregnane X Receptor and Indole-3-Propionic Acid Shape the Intestinal Mesenchyme to Restrain Inflammation and Fibrosis.",
            "journal": "Cellular and molecular gastroenterology and hepatology",
            "date": "2022-10-26",
            "authors": "Flannigan Kyle L, Nieves Kristoff M, Szczepanski Holly E, Serra Alex, Lee Joshua W, Alston Laurie A, Ramay Hena, Mani Sridhar, Hirota Simon A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36309199",
                    "url": "https://glygen.org/publication/PubMed/36309199"
                }
            ]
        },
        {
            "title": "PXR triggers YAP-TEAD binding and Sirt2-driven YAP deacetylation and polyubiquitination to promote liver enlargement and regeneration in mice.",
            "journal": "Pharmacological research",
            "date": "2023-02",
            "authors": "Zhang Shuaishuai, Guo Manlan, Jiang Xiaowen, Tang Lan, Wu Ting, Bi Guofang, Yang Xiao, Fan Shicheng, Bi Huichang",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36657504",
                    "url": "https://glygen.org/publication/PubMed/36657504"
                }
            ]
        },
        {
            "title": "Oral arsenic administration to humanizedUDP-glucuronosyltransferase1 neonatal mice induces UGT1A1 through a dependence on Nrf2 and PXR.",
            "journal": "The Journal of biological chemistry",
            "date": "2023-03",
            "authors": "Yang Xiaojing, Weber Andr\u00e9 A, Mennillo Elvira, Paszek Miles, Wong Samantha, Le Sabrina, Teo Jia Ying Ashley, Chang Max, Benner Christopher W, Tukey Robert H, Chen Shujuan",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36720308",
                    "url": "https://glygen.org/publication/PubMed/36720308"
                }
            ]
        },
        {
            "title": "Pregnane X receptor activation remodels glucose metabolism to promote NAFLD development in obese mice.",
            "journal": "Molecular metabolism",
            "date": "2023-10",
            "authors": "Karpale Mikko, Kummu Outi, K\u00e4rkk\u00e4inen Olli, Lehtonen Marko, N\u00e4p\u00e4nkangas Juha, Herfurth Uta M, Braeuning Albert, Rys\u00e4 Jaana, Hakkola Jukka",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001091874",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091874"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37467962",
                    "url": "https://glygen.org/publication/PubMed/37467962"
                }
            ]
        },
        {
            "title": "An orphan nuclear receptor activated by pregnanes defines a novel steroid signaling pathway.",
            "journal": "Cell",
            "date": "1998",
            "authors": "Kliewer SA, Moore JT, Wade L, Staudinger JL, Watson MA, Jones SA, McKee DD, Oliver BB, Willson TM, Zetterstrom RH, Perlmann T, Lehmann JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O54915",
                    "url": "https://www.uniprot.org/uniprot/O54915"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9489701",
                    "url": "https://glygen.org/publication/PubMed/9489701"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:18171",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18171",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-383280",
            "name": "Nuclear Receptor transcription pathway",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-383280",
            "resource": "Reactome",
            "description": "Nuclear Receptor transcription pathway"
        },
        {
            "id": "R-MMU-4090294",
            "name": "SUMOylation of intracellular receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-4090294",
            "resource": "Reactome",
            "description": "SUMOylation of intracellular receptors"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O75469-1",
            "protein_name": "Nuclear receptor subfamily 1 group I member 2",
            "gene_name": "NR1I2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS",
                "length": 434
            },
            "evidence": [
                {
                    "id": "45225800",
                    "url": "http://www.informatics.jax.org/homology/45225800",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9R1A7-1",
            "protein_name": "Nuclear receptor subfamily 1 group I member 2",
            "gene_name": "Nr1i2",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MRPEERWNHVGLVQREEADSVLEEPINVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSDCELPEVLQASLLEDPATWSQIMKDSVPMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISHFRELPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLREEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDTHPFATPLMQELFSSTDG",
                "length": 431
            },
            "evidence": [
                {
                    "id": "45225800",
                    "url": "http://www.informatics.jax.org/homology/45225800",
                    "database": "MGI"
                },
                {
                    "id": "O54915",
                    "url": "https://omabrowser.org/oma/group/O54915/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 10,
                "go_terms": [
                    {
                        "name": "negative regulation of transcription by RNA polymerase II",
                        "id": "GO:0000122",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of gene expression",
                        "id": "GO:0010628",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell differentiation",
                        "id": "GO:0030154",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription by RNA polymerase II",
                        "id": "GO:0045944",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of DNA-templated transcription",
                        "id": "GO:0006355",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of DNA-templated transcription",
                        "id": "GO:0045892",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "xenobiotic metabolic process",
                        "id": "GO:0006805",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of DNA-templated transcription",
                        "id": "GO:0045893",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "xenobiotic catabolic process",
                        "id": "GO:0042178",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042178",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "xenobiotic transport",
                        "id": "GO:0042908",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042908",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 4,
                "go_terms": [
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear body",
                        "id": "GO:0016604",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transcription regulator complex",
                        "id": "GO:0005667",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "intermediate filament cytoskeleton",
                        "id": "GO:0045111",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045111",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 7,
                "go_terms": [
                    {
                        "name": "zinc ion binding",
                        "id": "GO:0008270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
                        "id": "GO:0000977",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
                        "id": "GO:0000978",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear receptor activity",
                        "id": "GO:0004879",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004879",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA-binding transcription activator activity, RNA polymerase II-specific",
                        "id": "GO:0001228",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear receptor binding",
                        "id": "GO:0016922",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016922",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sequence-specific double-stranded DNA binding",
                        "id": "GO:1990837",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O54915",
                                "url": "https://www.uniprot.org/uniprot/O54915"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 10
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}