{ "uniprot_canonical_ac": "O54830-1", "uniprot_ac": "O54830", "uniprot_id": "PR7A1_MOUSE", "mass": { "chemical_mass": 29828.0, "monoisotopic_mass": 29828.0 }, "refseq": { "ac": "NP_001157530", "name": "prolactin-7A1 isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530" }, "gene_names": [ { "name": "Prl7a1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O54830", "id": "O54830" }, { "name": "PLP-E; PLP-G; Prlpe; Prlpg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530", "id": "NP_001157530" }, { "name": "Prl7a1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530", "id": "NP_001157530" }, { "name": "Prlpe", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O54830", "id": "O54830" }, { "name": "Prlpg", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O54830", "id": "O54830" } ], "protein_names": [ { "name": "Prolactin-7A1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O54830" }, { "name": "PLP-E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "PLP-G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "PRL-like protein E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "PRL-like protein G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "Placental prolactin-like protein E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "Placental prolactin-like protein G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O54830" }, { "name": "prolactin-7A1 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530", "id": "NP_001157530" }, { "name": "prolactin-7A1; PRL-like protein E; PRL-like protein G; placental prolactin-like protein E; placental prolactin-like protein G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530", "id": "NP_001157530" } ], "function": [ { "annotation": "Injection of PLP-E into thrombocytopenic mice restores normal platelet levels with no effect on granulocytes, erythrocytes, and total white blood cell counts", "evidence": [ { "database": "RefSeq", "id": "NP_001157530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530" }, { "database": "PubMed", "id": "12040023", "url": "https://glygen.org/publication/PubMed/12040023" } ] }, { "annotation": "Results show that PRL-like proteins E and F have the same stimulatory effects on megakaryocyte growth and differentiation", "evidence": [ { "database": "RefSeq", "id": "NP_001157530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530" }, { "database": "PubMed", "id": "12399423", "url": "https://glygen.org/publication/PubMed/12399423" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Prl7a1", "url": "https://www.uniprot.org/uniprot/O54830", "locus": { "chromosome": "13", "start_pos": 27817349, "end_pos": 27826476, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000006488", "url": "https://www.ensembl.org/id/ENSMUSG00000006488" } ] } } ], "crossref": [ { "id": "ENSMUSG00000006488", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000006488", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd10288", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10288", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "19113", "url": "https://www.ncbi.nlm.nih.gov/gene/19113", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:19113", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:19113", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1206572", "url": "http://www.informatics.jax.org/marker/MGI:1206572", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DICKSPR", "url": "https://omabrowser.org/oma/group/DICKSPR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4833588at2759", "url": "http://www.orthodb.org/?query=4833588at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00103", "url": "http://pfam.xfam.org/family/PF00103", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O54830", "url": "http://purl.obolibrary.org/obo/PR_O54830", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001157530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O54830-1", "url": "https://www.uniprot.org/uniprot/O54830-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O54830-2", "url": "https://www.uniprot.org/uniprot/O54830-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BMT3", "url": "https://www.uniprot.org/uniprot/Q8BMT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BMT3-1", "url": "https://www.uniprot.org/uniprot/Q8BMT3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPLSFTQPCSSGALLLLVVSNLLLWENVACLPLSSNDTDDDPLSIKGLLDHAMILSKNITDLNMELRRIFTISEMSAKLIDKFLSSSSSSDSYDQFMLEFLGQQELLTKNLTYCHKYSIKVPEDIEEAQNVISLEDFPILILSRMQAWNETLKNRINLSEGTPGIDDDILPIYKNIETKIAELLEDSKSILSQAYGATENVADYTLWSGLEDLQSSDEETRFLALCKLSYCLHVDIHTANFYLQFLRCVALVNSDSCLSSKTGNDS", "length": 266, "header": "sp|O54830-1|PR7A1_MOUSE Isoform 1 of Prolactin-7A1 OS=Mus musculus OX=10090 GN=Prl7a1 PE=2 SV=2 CANONICAL=O54830-1" }, "isoforms": [ { "isoform_ac": "O54830-1", "url": "", "sequence": { "sequence": "MPLSFTQPCSSGALLLLVVSNLLLWENVACLPLSSNDTDDDPLSIKGLLDHAMILSKNITDLNMELRRIFTISEMSAKLIDKFLSSSSSSDSYDQFMLEFLGQQELLTKNLTYCHKYSIKVPEDIEEAQNVISLEDFPILILSRMQAWNETLKNRINLSEGTPGIDDDILPIYKNIETKIAELLEDSKSILSQAYGATENVADYTLWSGLEDLQSSDEETRFLALCKLSYCLHVDIHTANFYLQFLRCVALVNSDSCLSSKTGNDS", "length": 266, "header": "sp|O54830-1|PR7A1_MOUSE Isoform 1 of Prolactin-7A1 OS=Mus musculus OX=10090 GN=Prl7a1 PE=2 SV=2 CANONICAL=O54830-1" }, "locus": { "chromosome": "13", "start_pos": 27826433, "end_pos": 27817465, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000095924", "url": "https://www.ensembl.org/id/ENSMUST00000095924" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000093614", "url": "https://www.ensembl.org/id/ENSMUSP00000093614" } ] } }, { "isoform_ac": "O54830-2", "url": "", "sequence": { "sequence": "MPLSFTQPCSWALLLLVVSNLLLWENVACLPLSSNDTDDDPLSIKGLLDHAMILSKNITDLNMELRRIFTISEMSAKLIDKFLSSSSSSDSYDQFMLEFLGQQELLTKNLTYCHKYSIKVPEDIEEAQNVISLEDFPILILSRMQAWNETLKNRINLSEGTPGIDDDILPIYKNIETKIAELLEDSKSILSQAYGATENVADYTLWSGLEDLQSSDEETRFLALCKLSYCLHVDIHTANFYLQFLRCVALVNSDSCLSSKTGNDS", "length": 265, "header": "sp|O54830-2|PR7A1_MOUSE Isoform 2 of Prolactin-7A1 OS=Mus musculus OX=10090 GN=Prl7a1 PE=2 SV=2 CANONICAL=O54830-1" }, "locus": { "chromosome": "13", "start_pos": 27826433, "end_pos": 27817465, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000006659", "url": "https://www.ensembl.org/id/ENSMUST00000006659" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000006659", "url": "https://www.ensembl.org/id/ENSMUSP00000006659" } ] } }, { "isoform_ac": "Q8BMT3-1", "url": "", "sequence": { "sequence": "MPLSFTQPCSWALLLLVVSNLLLWENVACLPLSSNDTDDDPLSIKGLLDHAMILSKNITDLNMELRRIFTISEMSAKLIDKFLSSSSSSDSYDQFMLEFLGQQELLTKNLTYCHKYSIKVPEDIEEAQNVISLEDFPILILSRMQAWNETLKNRINLSEGTPGIDDDILPIYKNIETKIAELLEDSKSILSQVSSDFTFYFSHS", "length": 204, "header": "tr|Q8BMT3-1|PR7A1_MOUSE Computationally mapped isoform of Prolactin-7A1 OS=Mus musculus OX=10090 GN=Prl7a1 PE=2 SV=1 CANONICAL=O54830-1" }, "locus": { "chromosome": "13", "start_pos": 27826433, "end_pos": 27819638, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000224852.2", "url": "https://www.ensembl.org/id/ENSMUST00000224852.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000153047.2", "url": "https://www.ensembl.org/id/ENSMUSP00000153047.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "O54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54830#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 149, "start_aa": "Asn", "end_pos": 149, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn149", "evidence": [ { "id": "O54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54830#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 157, "start_aa": "Asn", "end_pos": 157, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn157", "evidence": [ { "id": "O54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54830#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 36, "start_aa": "Asn", "end_pos": 36, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn36", "evidence": [ { "id": "O54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54830#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "O54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54830#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Reactivation of a hematopoietic endocrine program of pregnancy contributes to recovery from thrombocytopenia.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Bhattacharyya S, Lin J, Linzer DI", "evidence": [ { "database": "RefSeq", "id": "NP_001157530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530" } ], "reference": [ { "type": "PubMed", "id": "12040023", "url": "https://glygen.org/publication/PubMed/12040023" } ] }, { "title": "Two placental hormones are agonists in stimulating megakaryocyte growth and differentiation.", "journal": "Endocrinology", "date": "2002", "authors": "Zhou B, Lum HE, Lin J, Linzer DI", "evidence": [ { "database": "RefSeq", "id": "NP_001157530", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157530" } ], "reference": [ { "type": "PubMed", "id": "12399423", "url": "https://glygen.org/publication/PubMed/12399423" } ] }, { "title": "Two novel members of the prolactin/growth hormone family are expressed in the mouse placenta.", "journal": "Endocrinology", "date": "1997", "authors": "Lin J, Poole J, Linzer DI", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "reference": [ { "type": "PubMed", "id": "9389541", "url": "https://glygen.org/publication/PubMed/9389541" } ] }, { "title": "Identification of two new members of the mouse prolactin gene family.", "journal": "Biochim. Biophys. Acta", "date": "1998", "authors": "Muller H, Orwig KE, Soares MJ", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "reference": [ { "type": "PubMed", "id": "9545574", "url": "https://glygen.org/publication/PubMed/9545574" } ] } ], "pathway": [ { "id": "mmu:19113", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:19113", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "prolactin receptor binding", "id": "GO:0005148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005148", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "positive regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046427", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" }, { "name": "positive regulation of lactation", "id": "GO:1903489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903489", "evidence": [ { "database": "UniProtKB", "id": "O54830", "url": "https://www.uniprot.org/uniprot/O54830" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 149, "end_pos": 151, "annotation": "n_glycosylation_sequon" }, { "start_pos": 157, "end_pos": 159, "annotation": "n_glycosylation_sequon" }, { "start_pos": 264, "end_pos": 266, "annotation": "n_glycosylation_sequon" }, { "start_pos": 36, "end_pos": 38, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }