{ "uniprot_canonical_ac": "O46199-1", "uniprot_ac": "O46199", "uniprot_id": "A53E_DROME", "mass": { "chemical_mass": 13607.0, "monoisotopic_mass": 13607.0 }, "refseq": { "ac": "NP_477151", "name": "accessory gland protein 53Ea", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151" }, "gene_names": [ { "name": "Acp53Ea", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O46199", "id": "O46199" }, { "name": "Acp53E; ACP53EA; BcDNA:AT09943; CG8622; Dmel\\CG8622", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151", "id": "NP_477151" }, { "name": "Acp53Ea", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151", "id": "NP_477151" }, { "name": "CG8622", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O46199", "id": "O46199" } ], "protein_names": [ { "name": "Accessory gland protein Acp53Ea", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O46199" }, { "name": "CG8622-PA; Acp53Ea-PA; accessory gland-specific peptide 53Ea", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151", "id": "NP_477151" }, { "name": "accessory gland protein 53Ea", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151", "id": "NP_477151" } ], "function": [ { "annotation": "Responsible for physiological and behavioral changes in mated female flies.", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199#function" }, { "database": "PubMed", "id": "9474779", "url": "https://glygen.org/publication/PubMed/9474779" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Acp53Ea", "url": "https://www.uniprot.org/uniprot/O46199", "locus": { "chromosome": "2R", "start_pos": 16749803, "end_pos": 16750335, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0015584", "url": "https://www.ensembl.org/id/FBgn0015584" } ] } } ], "crossref": [ { "id": "FBgn0015584", "url": "https://bgee.org/?page=gene&gene_id=FBgn0015584", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0015584", "url": "https://flybase.org/reports/FBgn0015584", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "36874", "url": "https://www.ncbi.nlm.nih.gov/gene/36874", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O46199", "url": "https://www.ebi.ac.uk/intact/interactors/id:O46199*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009392", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009392", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG8622", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8622", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WLACNRI", "url": "https://omabrowser.org/oma/group/WLACNRI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3567812at2759", "url": "http://www.orthodb.org/?query=3567812at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF06313", "url": "http://pfam.xfam.org/family/PF06313", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O46199", "url": "http://purl.obolibrary.org/obo/PR_O46199", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_477151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_477151", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O46199-1", "url": "https://www.uniprot.org/uniprot/O46199-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLIKVTLVFSLLALVFVAQTEAQNPIWENWLACNRIGTKALASLLRETIPTVRNLLNCIDFNPPTDIGNSYLSKLKLYYELVKRGALDKTQCLIVPLKESVRLLRPYVKSLETNKCLGE", "length": 120, "header": "sp|O46199-1|A53E_DROME Isoform 1 of Accessory gland protein Acp53Ea OS=Drosophila melanogaster OX=7227 GN=Acp53Ea PE=2 SV=1 CANONICAL=O46199-1" }, "isoforms": [ { "isoform_ac": "O46199-1", "url": "", "sequence": { "sequence": "MKLIKVTLVFSLLALVFVAQTEAQNPIWENWLACNRIGTKALASLLRETIPTVRNLLNCIDFNPPTDIGNSYLSKLKLYYELVKRGALDKTQCLIVPLKESVRLLRPYVKSLETNKCLGE", "length": 120, "header": "sp|O46199-1|A53E_DROME Isoform 1 of Accessory gland protein Acp53Ea OS=Drosophila melanogaster OX=7227 GN=Acp53Ea PE=2 SV=1 CANONICAL=O46199-1" }, "locus": { "chromosome": "2R", "start_pos": 16750283, "end_pos": 16749859, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0087080", "url": "https://www.ensembl.org/id/FBtr0087080" }, { "database": "Ensembl Peptide", "id": "FBpp0086228", "url": "https://www.ensembl.org/id/FBpp0086228" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Molecular population genetics of male accessory gland proteins in Drosophila.", "journal": "Genetics", "date": "2000", "authors": "Begun DJ, Whitley P, Todd BL, Waldrip-Dail HM, Clark AG", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "11102381", "url": "https://glygen.org/publication/PubMed/11102381" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "Population genetics of accessory gland proteins and sexual behavior in Drosophila melanogaster populations from Evolution Canyon.", "journal": "Evolution", "date": "2003", "authors": "Panhuis TM, Swanson WJ, Nunney L", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "14761057", "url": "https://glygen.org/publication/PubMed/14761057" } ] }, { "title": "Molecular evolution and population genetics of duplicated accessory gland protein genes in Drosophila.", "journal": "Mol. Biol. Evol.", "date": "2004", "authors": "Holloway AK, Begun DJ", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "15215320", "url": "https://glygen.org/publication/PubMed/15215320" } ] }, { "title": "New genes for male accessory gland proteins in Drosophila melanogaster.", "journal": "Insect Biochem. Mol. Biol.", "date": "1997", "authors": "Park M., Bertram M.J., Wolfner M.F., Harada H.A., Kalb J.M., Kraus K.W., Lung Y.O., Neubaum D.M., Stelick T.J., Tram U.K.", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "reference": [ { "type": "PubMed", "id": "9474779", "url": "https://glygen.org/publication/PubMed/9474779" } ] } ], "pathway": [ { "id": "dme:Dmel_CG8622", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG8622", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "sexual reproduction", "id": "GO:0019953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019953", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "pmid": "" }, { "name": "sperm competition", "id": "GO:0046692", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046692", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O46199", "url": "https://www.uniprot.org/uniprot/O46199" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }