{ "uniprot_canonical_ac": "O35654-1", "uniprot_ac": "O35654", "uniprot_id": "DPOD2_MOUSE", "mass": { "chemical_mass": 51355.0, "monoisotopic_mass": 51355.0 }, "refseq": { "ac": "NP_032920", "name": "DNA polymerase delta subunit 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" }, "gene_names": [ { "name": "Pold2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O35654", "id": "O35654" }, { "name": "50kDa; p50; po1D2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920", "id": "NP_032920" }, { "name": "Pold2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920", "id": "NP_032920" } ], "protein_names": [ { "name": "DNA polymerase delta subunit 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O35654" }, { "name": "DNA polymerase delta subunit 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920", "id": "NP_032920" }, { "name": "DNA polymerase delta subunit p50", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920", "id": "NP_032920" }, { "name": "DNA polymerase delta subunit p50", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35654" } ], "function": [ { "annotation": "A direct interaction between Pold2 and PIAS2 was confirmed by direct yeast two-hybrid.", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" }, { "database": "PubMed", "id": "22824807", "url": "https://glygen.org/publication/PubMed/22824807" } ] }, { "annotation": "Accessory component of both the DNA polymerase delta complex and the DNA polymerase zeta complex. As a component of the trimeric and tetrameric DNA polymerase delta complexes (Pol-delta3 and Pol-delta4, respectively), plays a role in high fidelity genome replication, including in lagging strand synthesis, and repair. Pol-delta3 and Pol-delta4 are characterized by the absence or the presence of POLD4. They exhibit differences in catalytic activity. Most notably, Pol-delta3 shows higher proofreading activity than Pol-delta4. Although both Pol-delta3 and Pol-delta4 process Okazaki fragments in vitro, Pol-delta3 may also be better suited to fulfill this task, exhibiting near-absence of strand displacement activity compared to Pol-delta4 and stalling on encounter with the 5'-blocking oligonucleotides. Pol-delta3 idling process may avoid the formation of a gap, while maintaining a nick that can be readily ligated. Along with DNA polymerase kappa, DNA polymerase delta carries out approximately half of nucleotide excision repair (NER) synthesis following UV irradiation. Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR). Involved in the translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites performed by Pol-delta4, independently of DNA polymerase zeta (REV3L) or eta (POLH). Facilitates abasic site bypass by DNA polymerase delta by promoting extension from the nucleotide inserted opposite the lesion. Also involved in TLS as a component of the DNA polymerase zeta complex. Along with POLD3, dramatically increases the efficiency and processivity of DNA synthesis of the DNA polymerase zeta complex compared to the minimal zeta complex, consisting of only REV3L and REV7.", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654#function" }, { "database": "UniProtKB", "id": "P49005", "url": "https://www.uniprot.org/uniprot/P49005#function" } ] }, { "annotation": "Early embryonic lethality of mice lacking POLD2.", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" }, { "database": "PubMed", "id": "36528861", "url": "https://glygen.org/publication/PubMed/36528861" } ] }, { "annotation": "The association of PDIP38 with pol delta was shown to occur in calf thymus tissue and mammalian cell extracts by GST-PDIP38 pull-down and coimmunoprecipitation experiments.", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" }, { "database": "PubMed", "id": "12522211", "url": "https://glygen.org/publication/PubMed/12522211" } ] } ], "disease": [ { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pold2", "url": "https://www.uniprot.org/uniprot/O35654", "locus": { "chromosome": "11", "start_pos": 5822180, "end_pos": 5828292, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020471", "url": "https://www.ensembl.org/id/ENSMUSG00000020471" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020471", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020471", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07387", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07387", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "18972", "url": "https://www.ncbi.nlm.nih.gov/gene/18972", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "A8Y5G7", "url": "https://www.ebi.ac.uk/intact/interactors/id:A8Y5G7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O35654", "url": "https://www.ebi.ac.uk/intact/interactors/id:O35654*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007185", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007185", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024826", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024826", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040663", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040663", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041863", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041863", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:18972", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18972", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1097163", "url": "http://www.informatics.jax.org/marker/MGI:1097163", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "O35654", "url": "https://oglcnac.org/atlas/detail/O35654", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O35654", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DPANFML", "url": "https://omabrowser.org/oma/group/DPANFML/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1604at2759", "url": "http://www.orthodb.org/?query=1604at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10416", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10416", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10416:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10416:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04042", "url": "http://pfam.xfam.org/family/PF04042", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18018", "url": "http://pfam.xfam.org/family/PF18018", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O35654", "url": "http://purl.obolibrary.org/obo/PR_O35654", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-110314", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110314", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174411", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174411", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174414", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174414", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174417", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174417", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-174437", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174437", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5358565", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358565", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5358606", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5651801", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5651801", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5656169", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5685942", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5685942", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5693537", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5693537", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5696397", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5696397", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5696400", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5696400", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6782135", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6782210", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69091", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69166", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-69183", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69183", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8Y5G7", "url": "https://www.uniprot.org/uniprot/A8Y5G7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8Y5G7-1", "url": "https://www.uniprot.org/uniprot/A8Y5G7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O35654-1", "url": "https://www.uniprot.org/uniprot/O35654-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQMRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAEQEDLEGLGLGP", "length": 469, "header": "sp|O35654-1|DPOD2_MOUSE Isoform 1 of DNA polymerase delta subunit 2 OS=Mus musculus OX=10090 GN=Pold2 PE=1 SV=2 CANONICAL=O35654-1" }, "isoforms": [ { "isoform_ac": "A8Y5G7-1", "url": "", "sequence": { "sequence": "MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQMRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRV", "length": 241, "header": "tr|A8Y5G7-1|A8Y5G7_MOUSE Computationally mapped isoform of Polymerase (DNA directed), delta 2, regulatory subunit OS=Mus musculus OX=10090 GN=Pold2 PE=1 SV=1 CANONICAL=O35654-1" }, "locus": { "chromosome": "11", "start_pos": 5826932, "end_pos": 5824081, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000153995.2", "url": "https://www.ensembl.org/id/ENSMUST00000153995.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122906.2", "url": "https://www.ensembl.org/id/ENSMUSP00000122906.2" } ] } }, { "isoform_ac": "O35654-1", "url": "", "sequence": { "sequence": "MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQMRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQPSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLGSAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAEQEDLEGLGLGP", "length": 469, "header": "sp|O35654-1|DPOD2_MOUSE Isoform 1 of DNA polymerase delta subunit 2 OS=Mus musculus OX=10090 GN=Pold2 PE=1 SV=2 CANONICAL=O35654-1" }, "locus": { "chromosome": "11", "start_pos": 5826932, "end_pos": 5822261, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102922", "url": "https://www.ensembl.org/id/ENSMUST00000102922" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099986", "url": "https://www.ensembl.org/id/ENSMUSP00000099986" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 12, "start_aa": "Thr", "end_pos": 12, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr12", "evidence": [ { "id": "O35654", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "O35654", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O35654" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 18, "start_aa": "Ser", "end_pos": 18, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser18", "evidence": [ { "id": "O35654", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "O35654", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O35654" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 20, "start_aa": "Ser", "end_pos": 20, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser20", "evidence": [ { "id": "O35654", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "O35654", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O35654" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] } ], "phosphorylation": [ { "start_pos": 257, "end_pos": 257, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "site_lbl": "Ser257" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Liu L, Rodriguez-Belmonte EM, Mazloum N, Xie B, Lee MY", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" } ], "reference": [ { "type": "PubMed", "id": "12522211", "url": "https://glygen.org/publication/PubMed/12522211" } ] }, { "title": "Identification of Pold2 as a novel interaction partner of protein inhibitor of activated STAT2.", "journal": "International journal of molecular medicine", "date": "2012", "authors": "Zheng Y, Sheng S, Wang H, Jia X, Hu Y, Qian Y, Zhu Y, Wang J", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" } ], "reference": [ { "type": "PubMed", "id": "22824807", "url": "https://glygen.org/publication/PubMed/22824807" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "O35654", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O35654", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" }, { "database": "O-GlcNAc Atlas", "id": "O35654", "url": "https://oglcnac.org/atlas/detail/O35654" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "Cytosolic N-GlcNAc proteins are formed by the action of endo-beta-N-acetylglucosaminidase.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Maynard JC, Fujihira H, Dolgonos GE, Suzuki T, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O35654", "url": "https://oglcnac.org/atlas/detail/O35654" } ], "reference": [ { "type": "PubMed", "id": "32782141", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "title": "Early embryonic lethality of mice lacking POLD2.", "journal": "Molecular reproduction and development", "date": "2022-12-18", "authors": "Wu Xiaoqing, Liu Yong, Wang Wenying, Crimmings Kate, Williams Andrea, Mager Jesse, Cui Wei", "evidence": [ { "database": "RefSeq", "id": "NP_032920", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032920" } ], "reference": [ { "type": "PubMed", "id": "36528861", "url": "https://glygen.org/publication/PubMed/36528861" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "O35654", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O35654" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] }, { "title": "Cloning, chromosomal localization, and interspecies interaction of mouse DNA polymerase delta small subunit (PolD2).", "journal": "Genomics", "date": "1997", "authors": "Huebscher U., Hindges R.", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "reference": [ { "type": "PubMed", "id": "9286699", "url": "https://glygen.org/publication/PubMed/9286699" } ] } ], "pathway": [ { "id": "mmu:18972", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:18972", "resource": "KEGG Pathway" }, { "id": "R-MMU-110314", "name": "Recognition of DNA damage by PCNA-containing replication complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110314", "resource": "Reactome", "description": "Recognition of DNA damage by PCNA-containing replication complex" }, { "id": "R-MMU-174411", "name": "Polymerase switching on the C-strand of the telomere", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174411", "resource": "Reactome", "description": "Polymerase switching on the C-strand of the telomere" }, { "id": "R-MMU-174414", "name": "Processive synthesis on the C-strand of the telomere", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174414", "resource": "Reactome", "description": "Processive synthesis on the C-strand of the telomere" }, { "id": "R-MMU-174417", "name": "Telomere C-strand (Lagging Strand) Synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174417", "resource": "Reactome", "description": "Telomere C-strand (Lagging Strand) Synthesis" }, { "id": "R-MMU-174437", "name": "Removal of the Flap Intermediate from the C-strand", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174437", "resource": "Reactome", "description": "Removal of the Flap Intermediate from the C-strand" }, { "id": "R-MMU-5358565", "name": "Mismatch repair (MMR) directed by MSH2:MSH6 (MutSalpha)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358565", "resource": "Reactome", "description": "Mismatch repair (MMR) directed by MSH2:MSH6 (MutSalpha)" }, { "id": "R-MMU-5358606", "name": "Mismatch repair (MMR) directed by MSH2:MSH3 (MutSbeta)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5358606", "resource": "Reactome", "description": "Mismatch repair (MMR) directed by MSH2:MSH3 (MutSbeta)" }, { "id": "R-MMU-5651801", "name": "PCNA-Dependent Long Patch Base Excision Repair", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5651801", "resource": "Reactome", "description": "PCNA-Dependent Long Patch Base Excision Repair" }, { "id": "R-MMU-5656169", "name": "Termination of translesion DNA synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5656169", "resource": "Reactome", "description": "Termination of translesion DNA synthesis" }, { "id": "R-MMU-5685942", "name": "HDR through Homologous Recombination (HRR)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5685942", "resource": "Reactome", "description": "HDR through Homologous Recombination (HRR)" }, { "id": "R-MMU-5693537", "name": "Resolution of D-Loop Structures", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5693537", "resource": "Reactome", "description": "Resolution of D-Loop Structures" }, { "id": "R-MMU-5696397", "name": "Gap-filling DNA repair synthesis and ligation in GG-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5696397", "resource": "Reactome", "description": "Gap-filling DNA repair synthesis and ligation in GG-NER" }, { "id": "R-MMU-5696400", "name": "Dual Incision in GG-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5696400", "resource": "Reactome", "description": "Dual Incision in GG-NER" }, { "id": "R-MMU-6782135", "name": "Dual incision in TC-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6782135", "resource": "Reactome", "description": "Dual incision in TC-NER" }, { "id": "R-MMU-6782210", "name": "Gap-filling DNA repair synthesis and ligation in TC-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6782210", "resource": "Reactome", "description": "Gap-filling DNA repair synthesis and ligation in TC-NER" }, { "id": "R-MMU-69091", "name": "Polymerase switching", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69091", "resource": "Reactome", "description": "Polymerase switching" }, { "id": "R-MMU-69166", "name": "Removal of the Flap Intermediate", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69166", "resource": "Reactome", "description": "Removal of the Flap Intermediate" }, { "id": "R-MMU-69183", "name": "Processive synthesis on the lagging strand", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-69183", "resource": "Reactome", "description": "Processive synthesis on the lagging strand" } ], "orthologs": [ { "uniprot_canonical_ac": "P46957-1", "protein_name": "DNA polymerase delta small subunit", "gene_name": "POL31", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MDALLTKFNEDRSLQDENLSQPRTRVRIVDDNLYNKSNPFQLCYKKRDYGSQYYHIYQYRLKTFRERVLKECDKRWDAGFTLNGQLVLKKDKVLDIQGNQPCWCVGSIYCEMKYKPNVLDEVINDTYGAPDLTKSYTDKEGGSDEIMLEDESGRVLLVGDFIRSTPFITGVVVGILGMEAEAGTFQVLDICYPTPLPQNPFPAPIATCPTRGKIALVSGLNLNNTSPDRLLRLEILREFLMGRINNKIDDISLIGRLLICGNSVDFDIKSVNKDELMISLTEFSKFLHNILPSISVDIMPGTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNKEILNLVTNPYEFSYNGVDVLAVSGKNINDICKYVIPSNDNGESENKVEEGESNDFKDDIEHRLDLMECTMKWQNIAPTAPDTLWCYPYTDKDPFVLDKWPHVYIVANQPYFGTRVVEIGGKNIKIISVPEFSSTGMIILLDLETLEAETVKIDI", "length": 487 }, "evidence": [ { "id": "O35654", "url": "https://omabrowser.org/oma/group/O35654/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P49005-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "POLD2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP", "length": 469 }, "evidence": [ { "id": "45226021", "url": "http://www.informatics.jax.org/homology/45226021", "database": "MGI" }, { "id": "O35654", "url": "https://omabrowser.org/oma/group/O35654/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6AXY4-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "Pold2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFSEQAAQRAHTLLSPPSASNATFARVPVATYTNSSQPFRLGERSFNRQYAHIYATRLIQMRPFLVSRAQQHWGSQVEVKKLCELQPGEQCCVVGTLFKAMPLQPSILREISEEHNLIPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVKDDGKFQVEDHCFADLAPQNPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYATLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFAECPHVYFCGNTPSFGSKVIRGPEDQAVLLVAVPDFSSTQTACLVNLRGLTCQPISFAGFGAEQDDLEDLGLGP", "length": 469 }, "evidence": [ { "id": "45226021", "url": "http://www.informatics.jax.org/homology/45226021", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9W088-1", "protein_name": "DNA polymerase delta subunit 2", "gene_name": "PolD2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTNRLETKYENLSSIFRLKGHDYQKQFFHLYAHRLAEMTRLLTPLAQKKWGNKEPIKKLCELRGEQDVHCILIGTIFKHQAHKPSILRDISEENQLAPQPPRQNYSDPEDKIVLEDELQRVRLQGKLNGQLLATGVVCAALGGTDSDGFFNVEDILFYESGPQKPLAPIKRSRLLVLASGLDQLQAHKFVEALNLFQYWLAGSLGNNKEAGSMVRLIVAGNSVRASAMAHVPTLQVARTQANANDTVQAVSQLDQWFASWARSLPVDIMPGPYDPANFMLPQQPFHKCMFPQAAQLATFQAVTNPYSCRLDEALVVGTSGQNVSDLLRSTSLDSALEALRCTLTWGHVAPTAPDTLACYPYIESDPFILRECPHVYYAGNCESFATELHEGSEGKRTRLVCVPSFSKTQSVAVVDLDTLDCRMVNFSVDAE", "length": 431 }, "evidence": [ { "id": "O35654", "url": "https://omabrowser.org/oma/group/O35654/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "DNA biosynthetic process", "id": "GO:0071897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071897", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "DNA strand elongation involved in DNA replication", "id": "GO:0006271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006271", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "DNA replication", "id": "GO:0006260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "error-prone translesion synthesis", "id": "GO:0042276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042276", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "DNA-templated DNA replication", "id": "GO:0006261", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006261", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "delta DNA polymerase complex", "id": "GO:0043625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043625", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" }, { "name": "zeta DNA polymerase complex", "id": "GO:0016035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016035", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O35654", "url": "https://www.uniprot.org/uniprot/O35654" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 21, "end_pos": 23, "annotation": "n_glycosylation_sequon" }, { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 348, "end_pos": 350, "annotation": "n_glycosylation_sequon" }, { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }