{ "uniprot_canonical_ac": "O35469-1", "uniprot_ac": "O35469", "uniprot_id": "3BHS6_MOUSE", "mass": { "chemical_mass": 41977.0, "monoisotopic_mass": 41977.0 }, "refseq": { "ac": "NP_038849", "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038849" }, "gene_names": [ { "name": "Hsd3b6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O35469", "id": "O35469" }, { "name": "Hsd3b6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038849", "id": "NP_038849" } ], "protein_names": [ { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O35469" }, { "name": "1.1.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" }, { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038849", "id": "NP_038849" }, { "name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type VI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" }, { "name": "3-beta-HSD VI; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type VI; hydroxysteroid dehydrogenase-6, delta<5>-3-beta; 3beta-HSD VI; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 6 pseudogene", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038849", "id": "NP_038849" }, { "name": "3-beta-HSD VI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" }, { "name": "3-beta-hydroxy-5-ene steroid dehydrogenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" }, { "name": "Delta-5-3-ketosteroid isomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" }, { "name": "Progesterone reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35469" } ], "function": [ { "annotation": "3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. May be involved in local production of progesterone.", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469#function" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:10892", "recommended_name": { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "hypospadias", "description": "A physical disorder characterized by an abnormally placed urethral opening on the underside of the penis or on the perineum." }, "synonyms": [ { "id": "DOID:10892", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10892", "name": "familial hypospadias", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "hypospadias 3, autosomal, multifactorial", "description": "" }, { "id": "MONDO:0007802", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007802", "name": "HYSP3", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "HYSP4", "description": "" }, { "id": "MONDO:0010458", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010458", "name": "hypospadias 4, X-linked, susceptibility to", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "hypospadias 2, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010423", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010423", "name": "HYSP2", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "hypospadias 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010384", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010384", "name": "HYSP1", "description": "" }, { "id": "MIM:300758", "resource": "MIM", "url": "https://www.omim.org/entry/300758", "name": "Hypospadias 2, X-linked", "description": "Hypospadias 2, X-linked" }, { "id": "MIM:300633", "resource": "MIM", "url": "https://www.omim.org/entry/300633", "name": "Hypospadias 1, X-linked", "description": "Hypospadias 1, X-linked" } ], "evidence": [ { "id": "10892", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10892" } ] }, { "disease_id": "DOID:11612", "recommended_name": { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary syndrome", "description": "An ovarian dysfunction that is characterized by hyperandrogenism, polycystic ovaries, hirsutism, oligomenorrhea or amenorrhea, anovulation and excessive body weight." }, "synonyms": [ { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Multicystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "PCOS", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic Ovarian disease", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Polycystic ovaries", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "DOID:11612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11612", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "A disorder that manifests as multiple cysts on the ovaries. It results in hormonal imbalances and leads to irregular and abnormal menstrual periods, excess growth of hair, acne eruptions and obesity." }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal synd.", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "Stein-Leventhal syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "multicystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovarian disease", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovaries", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCOS1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "polycystic ovary syndrome 1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "PCO1", "description": "" }, { "id": "MONDO:0008487", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008487", "name": "hyperandrogenemia", "description": "" } ], "evidence": [ { "id": "11612", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11612" } ] }, { "disease_id": "DOID:12700", "recommended_name": { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinemia", "description": "An acquired metabolic disease that has_material_basis_in the presence of abnormally-high levels of prolactin in the blood." }, "synonyms": [ { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Chiari-Frommel syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "Pregnancy-related A-G syndrome", "description": "" }, { "id": "DOID:12700", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12700", "name": "hyperprolactinaemia", "description": "" } ], "evidence": [ { "id": "12700", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12700" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Hsd3b6", "url": "https://www.uniprot.org/uniprot/O35469", "locus": { "chromosome": "3", "start_pos": 98712820, "end_pos": 98721759, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027869", "url": "https://www.ensembl.org/id/ENSMUSG00000027869" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027869", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027869", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.145", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.145&UniProtAcc=O35469", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "15497", "url": "https://www.ncbi.nlm.nih.gov/gene/15497", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15497", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15497", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "109598", "url": "http://www.informatics.jax.org/marker/MGI:109598", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IIGVTHR", "url": "https://omabrowser.org/oma/group/IIGVTHR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3675908at2759", "url": "http://www.orthodb.org/?query=3675908at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43245", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43245", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43245:SF51", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43245:SF51", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01073", "url": "http://pfam.xfam.org/family/PF01073", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O35469", "url": "http://purl.obolibrary.org/obo/PR_O35469", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-193048", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-193993", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193993", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-194002", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-194002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_038849", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038849", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "14709", "url": "https://www.rhea-db.org/rhea/14709", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "24076", "url": "https://www.rhea-db.org/rhea/24076", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O35469-1", "url": "https://www.uniprot.org/uniprot/O35469-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLMQEKDLEEIRVLDKFFRPETREQFFNLDTNIKVTVLEGDILDTQYLRKACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIILNGNEEEHHESIWSDPYPYSKKMAEKAVLAANGSMLKIGGTLHTCALRPMYIYGERSPFISNTIITALKNKNILGCTGKFSTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCPDSSWSLPVPLLYWLAFMLETVSFLLSPIYRFIPPFNRHLVTLTGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|O35469-1|3BHS6_MOUSE Isoform 1 of 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus OX=10090 GN=Hsd3b6 PE=1 SV=4 CANONICAL=O35469-1" }, "isoforms": [ { "isoform_ac": "O35469-1", "url": "", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLMQEKDLEEIRVLDKFFRPETREQFFNLDTNIKVTVLEGDILDTQYLRKACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIILNGNEEEHHESIWSDPYPYSKKMAEKAVLAANGSMLKIGGTLHTCALRPMYIYGERSPFISNTIITALKNKNILGCTGKFSTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCPDSSWSLPVPLLYWLAFMLETVSFLLSPIYRFIPPFNRHLVTLTGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373, "header": "sp|O35469-1|3BHS6_MOUSE Isoform 1 of 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus OX=10090 GN=Hsd3b6 PE=1 SV=4 CANONICAL=O35469-1" }, "locus": { "chromosome": "3", "start_pos": 98718362, "end_pos": 98713179, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000170847", "url": "https://www.ensembl.org/id/ENSMUST00000170847" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000129911", "url": "https://www.ensembl.org/id/ENSMUSP00000129911" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Isolation of a new mouse 3beta-hydroxysteroid dehydrogenase isoform, 3beta-HSD VI, expressed during early pregnancy.", "journal": "Endocrinology", "date": "1997", "authors": "Abbaszade IG, Arensburg J, Park CH, Kasa-Vubu JZ, Orly J, Payne AH", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "reference": [ { "type": "PubMed", "id": "9075693", "url": "https://glygen.org/publication/PubMed/9075693" } ] } ], "pathway": [ { "id": "mmu:15497", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15497", "resource": "KEGG Pathway" }, { "id": "R-MMU-193048", "name": "Androgen biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193048", "resource": "Reactome", "description": "Androgen biosynthesis" }, { "id": "R-MMU-193993", "name": "Mineralocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193993", "resource": "Reactome", "description": "Mineralocorticoid biosynthesis" }, { "id": "R-MMU-194002", "name": "Glucocorticoid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-194002", "resource": "Reactome", "description": "Glucocorticoid biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P14060-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1", "gene_name": "HSD3B1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 373 }, "evidence": [ { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P26439-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2", "gene_name": "HSD3B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ", "length": 372 }, "evidence": [ { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q62878-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4", "gene_name": "Hsd3b6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPGWSCLVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLEGDILDTQCLRRACQGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAFIYCSTVDVAGPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERSPFLSVMILAALKSKGILNVTGKFSIANPVYVGNVAWAHILAARGLRDPKKSQNVQGQFYYISDDTPHQSYDDLNYTLSKEWGLHLDSSWSLPLPLLYWLAFLLEIVSFFLHPVYNYRPSFNRHLVTLSNSKFTFSYKKAQRDLGYKPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ", "length": 373 }, "evidence": [ { "id": "45227312", "url": "http://www.informatics.jax.org/homology/45227312", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "mitochondrial intermembrane space", "id": "GO:0005758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005758", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "intercellular bridge", "id": "GO:0045171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045171", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "hippocampus development", "id": "GO:0021766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "C21-steroid hormone biosynthetic process", "id": "GO:0006700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006700", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "steroid biosynthetic process", "id": "GO:0006694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006694", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "androgen biosynthetic process", "id": "GO:0006702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006702", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "C21-steroid hormone metabolic process", "id": "GO:0008207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008207", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "response to corticosterone", "id": "GO:0051412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051412", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "negative regulation of iron ion transport", "id": "GO:0034757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034757", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "3-beta-hydroxy-delta5-steroid dehydrogenase activity", "id": "GO:0003854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003854", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "steroid delta-isomerase activity", "id": "GO:0004769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004769", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "cholesterol dehydrogenase activity", "id": "GO:0102294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102294", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "O35469", "url": "https://www.uniprot.org/uniprot/O35469" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14709", "name": "", "equation": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22072-1", "P22071-1", "Q62878-1", "P14060-1", "P26439-1", "O35469-1", "P24815-1", "P26149-1", "P26150-1" ], "evidence": [ { "id": "14709", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14709" } ] }, { "id": "24076", "name": "", "equation": "a 3beta-hydroxy-Delta(5)-steroid + NAD(+) = a 3-oxo-Delta(5)-steroid + H(+) + NADH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22072-1", "P22071-1", "Q62878-1", "Q9H2F3-1", "P14060-1", "P26439-1", "O35469-1", "P26150-1", "P24815-1", "P26149-1", "Q9EQC1-1" ], "evidence": [ { "id": "24076", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/24076" } ] }, { "id": "R-MMU-193052", "name": "Pregn-5-ene-3,20-dione isomerizes to progesterone", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q61694-1", "Q61767-1", "O35469-1", "P24815-1" ], "evidence": [ { "id": "R-MMU-193052", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193052" } ] }, { "id": "R-MMU-193073", "name": "HSD2B1 dimer, HSD3B2 dimer isomerise DHA to ANDST", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-73473", "R-ALL-193079" ], "enzyme_list": [ "Q61694-1", "Q61767-1", "O35469-1", "P24815-1" ], "evidence": [ { "id": "R-MMU-193073", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193073" } ] }, { "id": "R-MMU-193961", "name": "Pregn-5-ene-3,20-dione-17-ol isomerizes to 17-hydroxyprogesterone", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q61694-1", "Q61767-1", "O35469-1", "P24815-1" ], "evidence": [ { "id": "R-MMU-193961", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-193961" } ] }, { "id": "R-MMU-196350", "name": "Pregnenolone is dehydrogenated to form pregn-5-ene-3,20-dione", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-196344" ], "enzyme_list": [ "Q61694-1", "Q61767-1", "O35469-1", "P24815-1" ], "evidence": [ { "id": "R-MMU-196350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196350" } ] }, { "id": "R-MMU-196372", "name": "17-Hydroxypregnenolone is dehydrogenated to form pregn-5-ene-3,20-dione-17-ol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-196366" ], "enzyme_list": [ "Q61694-1", "Q61767-1", "O35469-1", "P24815-1" ], "evidence": [ { "id": "R-MMU-196372", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-196372" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-193079", "participant_name": "ANDST [cytosol]", "crossref": [ { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-196344", "participant_name": "pregn-5-ene-3,20-dione [cytosol]", "crossref": [ { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" }, { "id": "63837", "database": "ChEBI", "url": "" }, { "id": "000096085295", "database": "ZINC", "url": "" }, { "id": "HMDB0062521", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-196366", "participant_name": "pregn-5-ene-3,20-dione-17-ol [cytosol]", "crossref": [ { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" }, { "id": "63843", "database": "ChEBI", "url": "" }, { "id": "000096085296", "database": "ZINC", "url": "" }, { "id": "HMDB0062522", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-73473", "participant_name": "NADH [cytosol]", "crossref": [ { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" }, { "id": "C00004", "database": "COMPOUND", "url": "" }, { "id": "57945", "database": "ChEBI", "url": "" }, { "id": "000008215403", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O35469", "gene_name": "Hsd3b6", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] }, { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "O35469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35469" } ] } ] }, { "uniprot_ac": "P14060", "gene_name": "HSD3B1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P14060", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14060" } ] } ] }, { "uniprot_ac": "P22071", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P22071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22071" } ] } ] }, { "uniprot_ac": "P22072", "gene_name": "Hsd3b", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P22072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22072" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P22072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22072" } ] } ] }, { "uniprot_ac": "P24815", "gene_name": "Hsd3b1", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P24815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24815" } ] } ] }, { "uniprot_ac": "P26149", "gene_name": "Hsd3b2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26149" } ] } ] }, { "uniprot_ac": "P26150", "gene_name": "Hsd3b3", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26150" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26150" } ] } ] }, { "uniprot_ac": "P26439", "gene_name": "HSD3B2", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P26439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26439" } ] } ] }, { "uniprot_ac": "Q61694", "gene_name": "Hsd3b5", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61694" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61694" } ] } ] }, { "uniprot_ac": "Q61767", "gene_name": "Hsd3b4", "activity": [ { "ec_number": "1.1.1.270", "activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61767" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q61767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61767" } ] } ] }, { "uniprot_ac": "Q62878", "gene_name": "Hsd3b6", "activity": [ { "ec_number": "5.3.3.1", "activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.", "evidence": [ { "id": "Q62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62878" } ] }, { "ec_number": "1.1.1.145", "activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "Q62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62878" } ] } ] }, { "uniprot_ac": "Q9EQC1", "gene_name": "Hsd3b7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9EQC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC1" } ] }, { "ec_number": "1.1.1.181", "activity": "7alpha-hydroxycholesterol + NAD(+) = 7alpha-hydroxycholest-4-en-3-one + H(+) + NADH.", "evidence": [ { "id": "Q9EQC1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQC1" } ] } ] }, { "uniprot_ac": "Q9H2F3", "gene_name": "HSD3B7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9H2F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2F3" } ] }, { "ec_number": "1.1.1.181", "activity": "7alpha-hydroxycholesterol + NAD(+) = 7alpha-hydroxycholest-4-en-3-one + H(+) + NADH.", "evidence": [ { "id": "Q9H2F3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H2F3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }