{ "uniprot_canonical_ac": "O35298-1", "uniprot_ac": "O35298", "uniprot_id": "AOAH_MOUSE", "mass": { "chemical_mass": 65155.0, "monoisotopic_mass": 65155.0 }, "refseq": { "ac": "NP_001268783", "name": "acyloxyacyl hydrolase isoform 2 preproprotein", "summary": "This genes encodes an enzyme that catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides. The encoded protein modulates host inflammatory response to gram-negative bacteria. The proprotein is further cleaved into a large and small chain that interact in a heterodimer. Alternative splicing results in multiple transcript variants for this gene. [provided by RefSeq, Aug 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, "gene_names": [ { "name": "Aoah", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O35298", "id": "O35298" }, { "name": "4930433E13Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783", "id": "NP_001268783" }, { "name": "Aoah", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783", "id": "NP_001268783" } ], "protein_names": [ { "name": "Acyloxyacyl hydrolase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O35298" }, { "name": "3.1.1.77", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O35298" }, { "name": "acyloxyacyl hydrolase isoform 2 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783", "id": "NP_001268783" } ], "function": [ { "annotation": "AOAH remodels arachidonic acid-containing phospholipid pools in a model of interstitial cystitis pain: A MAPP Network study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, { "database": "PubMed", "id": "32925915", "url": "https://glygen.org/publication/PubMed/32925915" } ] }, { "annotation": "Acyloxyacyl hydrolase deficiency induces chronic inflammation and bone loss in male mice.", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, { "database": "PubMed", "id": "36112153", "url": "https://glygen.org/publication/PubMed/36112153" } ] }, { "annotation": "Acyloxyacyl hydrolase promotes pulmonary defense by preventing alveolar macrophage tolerance. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, { "database": "PubMed", "id": "37498977", "url": "https://glygen.org/publication/PubMed/37498977" } ] }, { "annotation": "Produced by renal cortical tubule cells and secreted into urine, where it can deacylate lipopolysaccharides, a mechanism to limit inflammatory response to gram-negative bacteria in urinary tract", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, { "database": "PubMed", "id": "15155618", "url": "https://glygen.org/publication/PubMed/15155618" } ] }, { "annotation": "Recovery from the tolerant state induced by Gram-negative bacteria is greatly delayed in in mice that lack AOAH, a lipase that partially deacylates the bacterial cell-wall lipopolysaccharide.", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" }, { "database": "PubMed", "id": "18779055", "url": "https://glygen.org/publication/PubMed/18779055" } ] }, { "annotation": "Removes the secondary (acyloxyacyl-linked) fatty acyl chains from the lipid A region of bacterial lipopolysaccharides (LPS) (PubMed:12810692, PubMed:15155618, PubMed:17322564, PubMed:19860560). By breaking down LPS, terminates the host response to bacterial infection and prevents prolonged and damaging inflammatory responses (PubMed:17322564, PubMed:19860560, PubMed:28622363). In peritoneal macrophages, seems to be important for recovery from a state of immune tolerance following infection by Gram-negative bacteria (PubMed:18779055).", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298#function" }, { "database": "PubMed", "id": "12810692", "url": "https://glygen.org/publication/PubMed/12810692" }, { "database": "PubMed", "id": "17322564", "url": "https://glygen.org/publication/PubMed/17322564" }, { "database": "PubMed", "id": "18779055", "url": "https://glygen.org/publication/PubMed/18779055" }, { "database": "PubMed", "id": "28622363", "url": "https://glygen.org/publication/PubMed/28622363" }, { "database": "PubMed", "id": "19860560", "url": "https://glygen.org/publication/PubMed/19860560" }, { "database": "PubMed", "id": "15155618", "url": "https://glygen.org/publication/PubMed/15155618" } ] }, { "annotation": "This genes encodes an enzyme that catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides. The encoded protein modulates host inflammatory response to gram-negative bacteria. The proprotein is further cleaved into a large and small chain that interact in a heterodimer. Alternative splicing results in multiple transcript variants for this gene. [provided by RefSeq, Aug 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389271662", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389271662" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 486, "end_pos": 486, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IAT->NAT).", "chr_id": "13", "chr_pos": "21189235", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I486", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 262, "end_pos": 262, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" }, { "database": "PubMed", "id": "29343645", "url": "https://glygen.org/publication/PubMed/29343645" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Aoah", "url": "https://www.uniprot.org/uniprot/O35298", "locus": { "chromosome": "13", "start_pos": 21220787, "end_pos": 20978283, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000021322", "url": "https://www.ensembl.org/id/ENSMUSG00000021322" } ] } } ], "crossref": [ { "id": "ENSMUSG00000021322", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000021322", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.1.77", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.1.77&UniProtAcc=O35298", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01826", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01826", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "27052", "url": "https://www.ncbi.nlm.nih.gov/gene/27052", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0003094", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0003094", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR001087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008139", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008139", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036514", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036514", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039676", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039676", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:27052", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27052", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1350928", "url": "http://www.informatics.jax.org/marker/MGI:1350928", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PFCHLYP", "url": "https://omabrowser.org/oma/group/PFCHLYP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4166at2759", "url": "http://www.orthodb.org/?query=4166at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15010", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15010", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15010:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15010:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5W7D", "url": "https://www.rcsb.org/structure/5W7D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W7E", "url": "https://www.rcsb.org/structure/5W7E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W7F", "url": "https://www.rcsb.org/structure/5W7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00657", "url": "http://pfam.xfam.org/family/PF00657", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03489", "url": "http://pfam.xfam.org/family/PF03489", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O35298", "url": "http://purl.obolibrary.org/obo/PR_O35298", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12032", "url": "https://www.rhea-db.org/rhea/12032", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O35298-1", "url": "https://www.uniprot.org/uniprot/O35298-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FW74", "url": "https://www.uniprot.org/uniprot/Q5FW74", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FW74-1", "url": "https://www.uniprot.org/uniprot/Q5FW74-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQPQCHLYPLPQEAWESALEKARQVLRRSSTMKYPRSGRNICSLPFLTKICQKIELSIKKAVPFKDIDSDKHSVFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDGIPYEKKFCEGSQPRGIILLGDSAGAHFHIPPEWLTASQMSVNSFLNLPSALTDELNWPQLSGVTGFLDSTSGIEEKSIYHRLRKRNHCNHRDYQSISKNGASSRNLKNFIESLSRNQASDHPAIVLYAMIGNDVCNSKADTVPEMTTPEQMYANVMQTLTHLNSHLPNGSHVILYGLPDGTFLWDSLHNRYHPLGQLNKDVTYAQFFSFLRCLQLNPCNGWMSSNKTLRTLTSERAEQLSNTLKKIATTETFANFDLFYVDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASLLQANRVWEKIQLQWPHVLGKENPFNSQIEEVFGDQGGH", "length": 574, "header": "sp|O35298-1|AOAH_MOUSE Isoform 1 of Acyloxyacyl hydrolase OS=Mus musculus OX=10090 GN=Aoah PE=1 SV=1 CANONICAL=O35298-1" }, "isoforms": [ { "isoform_ac": "O35298-1", "url": "", "sequence": { "sequence": "MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQPQCHLYPLPQEAWESALEKARQVLRRSSTMKYPRSGRNICSLPFLTKICQKIELSIKKAVPFKDIDSDKHSVFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDGIPYEKKFCEGSQPRGIILLGDSAGAHFHIPPEWLTASQMSVNSFLNLPSALTDELNWPQLSGVTGFLDSTSGIEEKSIYHRLRKRNHCNHRDYQSISKNGASSRNLKNFIESLSRNQASDHPAIVLYAMIGNDVCNSKADTVPEMTTPEQMYANVMQTLTHLNSHLPNGSHVILYGLPDGTFLWDSLHNRYHPLGQLNKDVTYAQFFSFLRCLQLNPCNGWMSSNKTLRTLTSERAEQLSNTLKKIATTETFANFDLFYVDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASLLQANRVWEKIQLQWPHVLGKENPFNSQIEEVFGDQGGH", "length": 574, "header": "sp|O35298-1|AOAH_MOUSE Isoform 1 of Acyloxyacyl hydrolase OS=Mus musculus OX=10090 GN=Aoah PE=1 SV=1 CANONICAL=O35298-1" }, "locus": { "chromosome": "13", "start_pos": 21207504, "end_pos": 20978564, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000021757", "url": "https://www.ensembl.org/id/ENSMUST00000021757" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000021757", "url": "https://www.ensembl.org/id/ENSMUSP00000021757" } ] } }, { "isoform_ac": "Q5FW74-1", "url": "", "sequence": { "sequence": "MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQPQCHLYPLPQDNQLISRCPERFRDQY", "length": 145, "header": "tr|Q5FW74-1|Q5FW74_MOUSE Computationally mapped isoform of Aoah protein OS=Mus musculus OX=10090 GN=Aoah PE=2 SV=1 CANONICAL=O35298-1" }, "locus": { "chromosome": "13", "start_pos": 21035857, "end_pos": 20978564, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000221982.2", "url": "https://www.ensembl.org/id/ENSMUST00000221982.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000152286.2", "url": "https://www.ensembl.org/id/ENSMUSP00000152286.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 206, "start_aa": "Asn", "end_pos": 206, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn206", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298#ptm_processing" }, { "id": "5W7E", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5W7E" }, { "id": "29343645", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29343645" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 408, "start_aa": "Asn", "end_pos": 408, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn408", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298#ptm_processing" }, { "id": "5W7D", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5W7D" }, { "id": "29343645", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29343645" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 465, "start_aa": "Asn", "end_pos": 465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn465", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298#ptm_processing" }, { "id": "29343645", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29343645" }, { "id": "5W7F", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/5W7F" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Stimulus-dependent deacylation of bacterial lipopolysaccharide by dendritic cells.", "journal": "J. Exp. Med.", "date": "2003", "authors": "Lu M, Zhang M, Kitchens RL, Fosmire S, Takashima A, Munford RS", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "reference": [ { "type": "PubMed", "id": "12810692", "url": "https://glygen.org/publication/PubMed/12810692" } ] }, { "title": "Identification of acyloxyacyl hydrolase, a lipopolysaccharide-detoxifying enzyme, in the murine urinary tract.", "journal": "Infect. Immun.", "date": "2004", "authors": "Feulner JA, Lu M, Shelton JM, Zhang M, Richardson JA, Munford RS", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" }, { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ], "reference": [ { "type": "PubMed", "id": "15155618", "url": "https://glygen.org/publication/PubMed/15155618" } ] }, { "title": "A host lipase detoxifies bacterial lipopolysaccharides in the liver and spleen.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Shao B, Lu M, Katz SC, Varley AW, Hardwick J, Rogers TE, Ojogun N, Rockey DC, Dematteo RP, Munford RS", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "reference": [ { "type": "PubMed", "id": "17322564", "url": "https://glygen.org/publication/PubMed/17322564" } ] }, { "title": "Host inactivation of bacterial lipopolysaccharide prevents prolonged tolerance following gram-negative bacterial infection.", "journal": "Cell Host Microbe", "date": "2008", "authors": "Lu M, Varley AW, Ohta S, Hardwick J, Munford RS", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" }, { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ], "reference": [ { "type": "PubMed", "id": "18779055", "url": "https://glygen.org/publication/PubMed/18779055" } ] }, { "title": "Overproduction of acyloxyacyl hydrolase by macrophages and dendritic cells prevents prolonged reactions to bacterial lipopolysaccharide in vivo.", "journal": "J. Infect. Dis.", "date": "2009", "authors": "Munford R.S., Greaves D.R., Varley A.W., Kuang T.Y., Ojogun N., Shao B.", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "reference": [ { "type": "PubMed", "id": "19860560", "url": "https://glygen.org/publication/PubMed/19860560" } ] }, { "title": "Acyloxyacyl hydrolase promotes the resolution of lipopolysaccharide-induced acute lung injury.", "journal": "PLoS Pathog.", "date": "2017", "authors": "Zou B, Jiang W, Han H, Li J, Mao W, Tang Z, Yang Q, Qian G, Qian J, Zeng W, Gu J, Chu T, Zhu N, Zhang W, Yan D, He R, Chu Y, Lu M", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "reference": [ { "type": "PubMed", "id": "28622363", "url": "https://glygen.org/publication/PubMed/28622363" } ] }, { "title": "Crystal structure of the mammalian lipopolysaccharide detoxifier.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Gorelik A, Illes K, Nagar B", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298#ptm_processing" }, { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "reference": [ { "type": "PubMed", "id": "29343645", "url": "https://glygen.org/publication/PubMed/29343645" } ] }, { "title": "AOAH remodels arachidonic acid-containing phospholipid pools in a model of interstitial cystitis pain: A MAPP Network study.", "journal": "PloS one", "date": "2020", "authors": "Yang W, Yaggie RE, Schaeffer AJ, Klumpp DJ", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ], "reference": [ { "type": "PubMed", "id": "32925915", "url": "https://glygen.org/publication/PubMed/32925915" } ] }, { "title": "Acyloxyacyl hydrolase deficiency induces chronic inflammation and bone loss in male mice.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2022-11", "authors": "Cheng Xu, Song Xiaoting, Li Zhiyan, Yuan Chiting, Lei Xinhuan, Feng Mingxuan, Hong Zhenghua, Zhang Liwei, Hong Dun", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ], "reference": [ { "type": "PubMed", "id": "36112153", "url": "https://glygen.org/publication/PubMed/36112153" } ] }, { "title": "Acyloxyacyl hydrolase promotes pulmonary defense by preventing alveolar macrophage tolerance.", "journal": "PLoS pathogens", "date": "2023-07", "authors": "Cheng Xiaofang, Jiang Wei, Chen Yeying, Zou Benkun, Wang Zhiyan, Gan Lu, Xiao Zeling, Li Changshun, Yu Cheng-Yun, Lu Yimeng, Han Zeyao, Zeng Jiashun, Gu Jie, Chu Tianqing, Fu Mingsheng, Chu Yiwei, Zhang Wenhong, Tang Jianguo, Lu Mingfang", "evidence": [ { "database": "RefSeq", "id": "NP_001268783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001268783" } ], "reference": [ { "type": "PubMed", "id": "37498977", "url": "https://glygen.org/publication/PubMed/37498977" } ] } ], "pathway": [ { "id": "mmu:27052", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27052", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K753-1", "protein_name": "Acyloxyacyl hydrolase", "gene_name": "Aoah", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKPPRKVFKTTLLFLLLSHSLASVPYESQPGASSSHGQNCVGCVVVISLIEQLAEVHNSSVQVAMERLCSYLPEKLFLKPSCYFLVQTFGSDIIKLLGEAMKADVVCYALEFCKQDAVQSQCHLYSLPQEAWKSSLEKARQVLRKSSTMKYSRSGHNICSLPFFTKICQKIELSMKKAVPFKDGDSDKYSVFPTLRGYHWRGRDCNDKDKTVYPGRRPDNWDIHQDSNCNGIWGIDPKDGIPYEKKFCEGSQPKGIILLGDSAGAHFHIPPEWLTASQMSVKSFSNLPSALTDELNWPQLSGVTGFLDSTSGIEEKSIYHHLRKRNHCNHRDYQSISKNGASSRNLKNFIESLSRNQALDHPAIVIYAMIGNDVCNGRADTIPGMTTPEQMYANVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDSLHNRYHPLGQLNKDVTYAQFFSFLSCLQVSPCNGWMSSNKTLRALTSERAEQLSNILKKIATTKTFANFDLFYMDFAFHEIIEDWQKRGGQPWQLIEPVDGFHPNEVASLLLANRVWKKIQLQWPHVLGKENPFNSQIEEVFGDQGGH", "length": 574 }, "evidence": [ { "id": "45240365", "url": "http://www.informatics.jax.org/homology/45240365", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P28039-1", "protein_name": "Acyloxyacyl hydrolase", "gene_name": "AOAH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKARQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQLSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH", "length": 575 }, "evidence": [ { "id": "45240365", "url": "http://www.informatics.jax.org/homology/45240365", "database": "MGI" }, { "id": "O35298", "url": "https://omabrowser.org/oma/group/O35298/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "lipopolysaccharide catabolic process", "id": "GO:0009104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009104", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" }, { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" }, { "name": "lipopolysaccharide metabolic process", "id": "GO:0008653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008653", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" }, { "name": "acyloxyacyl hydrolase activity", "id": "GO:0050528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050528", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 206, "end_pos": 208, "annotation": "n_glycosylation_sequon" }, { "start_pos": 408, "end_pos": 410, "annotation": "n_glycosylation_sequon" }, { "start_pos": 465, "end_pos": 467, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Cleaved into a large and a small subunit.", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" }, { "database": "PubMed", "id": "P28039", "url": "https://glygen.org/publication/PubMed/P28039" } ] }, { "annotation": "The small subunit is N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O35298", "url": "https://www.uniprot.org/uniprot/O35298" }, { "database": "PubMed", "id": "P28039", "url": "https://glygen.org/publication/PubMed/P28039" } ] } ], "interactions": [], "reactions": [ { "id": "12032", "name": "", "equation": "a 3-(acyloxy)acyl derivative of bacterial toxin + H2O = 3-hydroxyacyl derivative of bacterial toxin + a fatty acid + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P28039-1", "O35298-1" ], "evidence": [ { "id": "12032", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12032" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O35298", "gene_name": "Aoah", "activity": [ { "ec_number": "3.1.1.77", "activity": "a 3-(acyloxy)acyl derivative of bacterial toxin + H2O = 3-hydroxyacyl derivative of bacterial toxin + a fatty acid + H(+).", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298" } ] }, { "ec_number": "3.1.1.77", "activity": "", "evidence": [ { "id": "O35298", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35298" } ] } ] }, { "uniprot_ac": "P28039", "gene_name": "AOAH", "activity": [ { "ec_number": "3.1.1.77", "activity": "a 3-(acyloxy)acyl derivative of bacterial toxin + H2O = 3-hydroxyacyl derivative of bacterial toxin + a fatty acid + H(+).", "evidence": [ { "id": "P28039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28039" } ] }, { "ec_number": "3.1.1.77", "activity": "", "evidence": [ { "id": "P28039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28039" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }