{ "uniprot_canonical_ac": "O09008-1", "uniprot_ac": "O09008", "uniprot_id": "MFNG_MOUSE", "mass": { "chemical_mass": 36200.0, "monoisotopic_mass": 36200.0 }, "refseq": { "ac": "NP_032621", "name": "beta-1,3-N-acetylglucosaminyltransferase manic fringe isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621" }, "gene_names": [ { "name": "Mfng", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O09008", "id": "O09008" }, { "name": "Mfng", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621", "id": "NP_032621" } ], "protein_names": [ { "name": "Beta-1,3-N-acetylglucosaminyltransferase manic fringe", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O09008" }, { "name": "2.4.1.222", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09008" }, { "name": "O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09008" }, { "name": "beta-1,3-N-acetylglucosaminyltransferase manic fringe isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621", "id": "NP_032621" }, { "name": "beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; manic fringe homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621", "id": "NP_032621" } ], "function": [ { "annotation": "Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-like domains resulting in inhibition of NOTCH1 activation by JAG1 and enhancement of NOTCH1 activation by DLL1 via an increase in its binding to DLL1.", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008#function" }, { "database": "PubMed", "id": "28089369", "url": "https://glygen.org/publication/PubMed/28089369" } ] }, { "annotation": "MFNG imposes a negative correlation between Jag1 and Notch, being high Jag1 in the absence of MFNG predictive of poor prognosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_032621", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621" }, { "database": "PubMed", "id": "30065304", "url": "https://glygen.org/publication/PubMed/30065304" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mfng", "url": "https://www.uniprot.org/uniprot/O09008", "locus": { "chromosome": "15", "start_pos": 78640082, "end_pos": 78657675, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000018169", "url": "https://www.ensembl.org/id/ENSMUSG00000018169" } ] } } ], "crossref": [ { "id": "ENSMUSG00000018169", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000018169", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.4.1.222", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.222&UniProtAcc=O09008", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT31", "url": "http://www.cazy.org/GT31.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "17305", "url": "https://www.ncbi.nlm.nih.gov/gene/17305", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:17305", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17305", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1095404", "url": "http://www.informatics.jax.org/marker/MGI:1095404", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GSHFVDT", "url": "https://omabrowser.org/oma/group/GSHFVDT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2902544at2759", "url": "http://www.orthodb.org/?query=2902544at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10811", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10811", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10811:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10811:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2J0A", "url": "https://www.rcsb.org/structure/2J0A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2J0B", "url": "https://www.rcsb.org/structure/2J0B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02434", "url": "http://pfam.xfam.org/family/PF02434", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O09008", "url": "http://purl.obolibrary.org/obo/PR_O09008", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_032621", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "70511", "url": "https://www.rhea-db.org/rhea/70511", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70531", "url": "https://www.rhea-db.org/rhea/70531", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O09008-1", "url": "https://www.uniprot.org/uniprot/O09008-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLLAAP", "length": 321, "header": "sp|O09008-1|MFNG_MOUSE Isoform 1 of Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1 CANONICAL=O09008-1" }, "isoforms": [ { "isoform_ac": "O09008-1", "url": "", "sequence": { "sequence": "MHCRLFRGMAGALFTLLCVGLLSLRYHSSLSQRMIQGALRLNQRNPGPLELQLGDIFIAVKTTWAFHRSRLDLLLDTWVSRIRQQTFIFTDSPDERLQERLGPHLVVTNCSAEHSHPALSCKMAAEFDAFLVSGLRWFCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVRFWFATGGAGFCINRQLALKMVPWASGSHFVDTSALIRLPDDCTVGYIIECKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPGPFSHEEDPSRFRSLHCLLYPDTPWCPLLAAP", "length": 321, "header": "sp|O09008-1|MFNG_MOUSE Isoform 1 of Beta-1,3-N-acetylglucosaminyltransferase manic fringe OS=Mus musculus OX=10090 GN=Mfng PE=1 SV=1 CANONICAL=O09008-1" }, "locus": { "chromosome": "15", "start_pos": 78657472, "end_pos": 78640781, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000018313", "url": "https://www.ensembl.org/id/ENSMUST00000018313" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000018313", "url": "https://www.ensembl.org/id/ENSMUSP00000018313" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "O09008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09008#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "O09008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09008#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Structural insights into the Notch-modifying glycosyltransferase Fringe.", "journal": "Nat. Struct. Mol. Biol.", "date": "2006", "authors": "Clausen H., Conti E., Chen Y.W., Jinek M., Cohen S.M.", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "reference": [ { "type": "PubMed", "id": "16964258", "url": "https://glygen.org/publication/PubMed/16964258" } ] }, { "title": "Deciphering the fringe-mediated notch code: identification of activating and inhibiting sites allowing discrimination between ligands.", "journal": "Dev. Cell", "date": "2017", "authors": "Kakuda S, Haltiwanger RS", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "reference": [ { "type": "PubMed", "id": "28089369", "url": "https://glygen.org/publication/PubMed/28089369" } ] }, { "title": "Manic Fringe deficiency imposes Jagged1 addiction to intestinal tumor cells.", "journal": "Nature communications", "date": "2018", "authors": "Lopez-Arribillaga E, Rodilla V, Colomer C, Vert A, Shelton A, Cheng JH, Yan B, Gonzalez-Perez A, Junttila MR, Iglesias M, Torres F, Albanell J, Villanueva A, Bigas A, Siebel CW, Espinosa L", "evidence": [ { "database": "RefSeq", "id": "NP_032621", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_032621" } ], "reference": [ { "type": "PubMed", "id": "30065304", "url": "https://glygen.org/publication/PubMed/30065304" } ] }, { "title": "A family of mammalian Fringe genes implicated in boundary determination and the Notch pathway.", "journal": "Development", "date": "1997", "authors": "Johnston SH, Rauskolb C, Wilson R, Prabhakaran B, Irvine KD, Vogt TF", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "reference": [ { "type": "PubMed", "id": "9187150", "url": "https://glygen.org/publication/PubMed/9187150" } ] }, { "title": "Fringe boundaries coincide with Notch-dependent patterning centres in mammals and alter Notch-dependent development in Drosophila.", "journal": "Nat. Genet.", "date": "1997", "authors": "Cohen B, Bashirullah A, Dagnino L, Campbell C, Fisher WW, Leow CC, Whiting E, Ryan D, Zinyk D, Boulianne G, Hui CC, Gallie B, Phillips RA, Lipshitz HD, Egan SE", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "reference": [ { "type": "PubMed", "id": "9207795", "url": "https://glygen.org/publication/PubMed/9207795" } ] } ], "pathway": [ { "id": "mmu:17305", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17305", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O00587-1", "protein_name": "Beta-1,3-N-acetylglucosaminyltransferase manic fringe", "gene_name": "MFNG", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR", "length": 321 }, "evidence": [ { "id": "45226825", "url": "http://www.informatics.jax.org/homology/45226825", "database": "MGI" }, { "id": "O09008", "url": "https://omabrowser.org/oma/group/O09008/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of protein binding", "id": "GO:0032092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032092", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "positive regulation of Notch signaling pathway", "id": "GO:0045747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045747", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "pattern specification process", "id": "GO:0007389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007389", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "marginal zone B cell differentiation", "id": "GO:0002315", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002315", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "blastocyst formation", "id": "GO:0001825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001825", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "regulation of Notch signaling pathway", "id": "GO:0008593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008593", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" }, { "name": "O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity", "id": "GO:0033829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033829", "evidence": [ { "database": "UniProtKB", "id": "O09008", "url": "https://www.uniprot.org/uniprot/O09008" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 109, "end_pos": 111, "annotation": "n_glycosylation_sequon" }, { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "70511", "name": "", "equation": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q924T4-1", "Q9R1U9-1", "Q9Y644-1", "O00587-1", "Q8NES3-1", "O09008-1", "O09010-1", "O09009-1", "Q24342-1" ], "evidence": [ { "id": "70511", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70511" } ] }, { "id": "70531", "name": "", "equation": "3-O-(alpha-L-fucosyl)-L-threonyl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-threonyl-[EGF-like domain protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q924T4-1", "Q9R1U9-1", "Q9Y644-1", "O00587-1", "Q8NES3-1", "O09008-1", "O09010-1", "O09009-1", "Q24342-1" ], "evidence": [ { "id": "70531", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70531" } ] }, { "id": "R-MMU-2023158", "name": "Glycosylation of Pre-Notch by Fringe", "equation": "", "summary": "Mouse Notch1 fragment containing EGF repeats 19-23, with a conserved O-fucosylation site in EGF repeat 20, was shown to be a direct target of manic fringe (Mfng) when both mouse Notch1 fragment and Mfng were exogenously expressed in a Chinese hamster ovary cell line (Moloney et al. 2000). Lunatic fringe was shown to directly act on Notch1 to modulate its signaling (Hicks et al. 2000). Fringe enzymes include lunatic fringe (Lfng), manic fringe (Mfng) and radical fringe (Rfng) in mammals. Fringe enzymes localize to Golgi membrane and function by extending O-fucosyl residues on fucosylated peptides, including Notch, by transferring a beta 1,3-linked N-acetyl glucosaminyl group. Since the exact preference, if any, of fringe enzymes for Notch O-fucose sites is not known, the extension of an O-fucosyl residue at unknown position is shown.", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O09009-1", "O09010-1", "O09008-1" ], "evidence": [ { "id": "R-MMU-2023158", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2023158" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O00587", "gene_name": "MFNG", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "O00587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00587" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "O00587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00587" } ] } ] }, { "uniprot_ac": "O09008", "gene_name": "Mfng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "O09008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09008" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "O09008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09008" } ] } ] }, { "uniprot_ac": "O09009", "gene_name": "Rfng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "O09009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09009" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "O09009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09009" } ] } ] }, { "uniprot_ac": "O09010", "gene_name": "Lfng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "O09010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09010" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "O09010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09010" } ] } ] }, { "uniprot_ac": "Q24342", "gene_name": "fng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "Q24342", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24342" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "Q24342", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24342" } ] } ] }, { "uniprot_ac": "Q8NES3", "gene_name": "LFNG", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "Q8NES3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NES3" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "Q8NES3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NES3" } ] } ] }, { "uniprot_ac": "Q924T4", "gene_name": "Lfng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "Q924T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924T4" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "Q924T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924T4" } ] } ] }, { "uniprot_ac": "Q9R1U9", "gene_name": "Rfng", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "Q9R1U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1U9" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "Q9R1U9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R1U9" } ] } ] }, { "uniprot_ac": "Q9Y644", "gene_name": "RFNG", "activity": [ { "ec_number": "2.4.1.222", "activity": "3-O-(alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->3)-alpha-L-fucosyl)-L-seryl-[EGF-like domain protein] + H(+) + UDP.", "evidence": [ { "id": "Q9Y644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y644" } ] }, { "ec_number": "2.4.1.222", "activity": "", "evidence": [ { "id": "Q9Y644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y644" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }