{ "uniprot_canonical_ac": "O09005-1", "uniprot_ac": "O09005", "uniprot_id": "DEGS1_MOUSE", "mass": { "chemical_mass": 38241.0, "monoisotopic_mass": 38241.0 }, "refseq": { "ac": "NP_031879", "name": "sphingolipid delta(4)-desaturase DES1 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" }, "gene_names": [ { "name": "Degs1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O09005", "id": "O09005" }, { "name": "Degs1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879", "id": "NP_031879" }, { "name": "Degs; Des1; Mdes", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879", "id": "NP_031879" }, { "name": "Degs", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O09005", "id": "O09005" }, { "name": "Des1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O09005", "id": "O09005" }, { "name": "Mdes", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O09005", "id": "O09005" } ], "protein_names": [ { "name": "Sphingolipid delta(4)-desaturase DES1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O09005" }, { "name": "1.14.19.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09005" }, { "name": "5.2.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09005" }, { "name": "Degenerative spermatocyte homolog 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09005" }, { "name": "Dihydroceramide desaturase-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09005" }, { "name": "Retinol isomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O09005" }, { "name": "sphingolipid delta(4)-desaturase DES1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879", "id": "NP_031879" }, { "name": "sphingolipid delta(4)-desaturase DES1; dihydroceramide desaturase; degenerative spermatocyte homolog 1; dihydroceramide desaturase-1; retinol isomerase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879", "id": "NP_031879" } ], "function": [ { "annotation": "Biochemical assays, cellular lipid feeding experiments, and pharmacological blockade of ceramide synthase (dihydroceramide desaturase) together show that this enzyme indeed controls the flux of ceramides on maturing phagosomes.", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" }, { "database": "PubMed", "id": "29963848", "url": "https://glygen.org/publication/PubMed/29963848" } ] }, { "annotation": "Des1 expression in Muller cells is not required for cone visual pigment regeneration in the mouse.", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" }, { "database": "PubMed", "id": "30645148", "url": "https://glygen.org/publication/PubMed/30645148" } ] }, { "annotation": "GT11 is the first specific inhibitor of dihydroceramide desaturase described so far", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" }, { "database": "PubMed", "id": "15371559", "url": "https://glygen.org/publication/PubMed/15371559" } ] }, { "annotation": "Has sphingolipid-delta-4-desaturase activity. Converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine). Catalyzes the equilibrium isomerization of retinols (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005#function" }, { "database": "PubMed", "id": "11937514", "url": "https://glygen.org/publication/PubMed/11937514" }, { "database": "UniProtKB", "id": "Q5F3C1", "url": "https://www.uniprot.org/uniprot/Q5F3C1#function" } ] }, { "annotation": "These studies suggest that inhibition of DES1 may provide a means of treating hepatic steatosis and metabolic disorders", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" }, { "database": "PubMed", "id": "31273070", "url": "https://glygen.org/publication/PubMed/31273070" } ] } ], "disease": [ { "disease_id": "DOID:0060786", "recommended_name": { "id": "DOID:0060786", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060786", "name": "hypomyelinating leukodystrophy", "description": "A leukodystrophy characterized by improper formation of the myelin sheath in the central nervous system resulting in T2 hyperintensity and variable T1 signal on magnetic resonance imaging." }, "synonyms": [ { "id": "DOID:0060786", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060786", "name": "HLD", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus-Merzbacher disease", "description": "An X-linked leukodystrophy characterized by developmental delay, nystagmus, hypotonia, spasticity, and variable intellectual deficit. It is classified into three sub-forms based on the age of onset and severity: connatal, transitional, and classic PMD." }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "HLD1", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "PMD", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus Merzbacher brain sclerosis", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus-Merzbacher brain sclerosis", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus-Merzbacher disease", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus-Merzbacher disease, X-linked recessive", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Sudanophilic leukodystrophy, Paelizeus-Merzbacher type", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "diffuse familial brain sclerosis", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "hypomyelinating leukodystrophy 1", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "leukodystrophy, sudanophilic", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "sudanophilic leukodystrophy, Paelizeus-Merzbacher type", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "Pelizaeus Merzbacher disease", "description": "" }, { "id": "MONDO:0010714", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010714", "name": "leukodystrophy, hypomyelinating, 1", "description": "" }, { "id": "MIM:312080", "resource": "MIM", "url": "https://www.omim.org/entry/312080", "name": "Leukodystrophy, hypomyelinating, 1", "description": "Leukodystrophy, hypomyelinating, 1" } ], "evidence": [ { "id": "0060786", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060786" } ] }, { "disease_id": "DOID:0070399", "recommended_name": { "id": "DOID:0070399", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070399", "name": "hypomyelinating leukodystrophy 18", "description": "A hypomyelinating leukodystrophy characterized by onset of global developmental delay in infancy or early childhood that has_material_basis_in homozygous or compound heterozygous mutation in the DEGS1 gene on chromosome 1q42." }, "synonyms": [ { "id": "DOID:0070399", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070399", "name": "HLD18", "description": "" }, { "id": "MONDO:0032730", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032730", "name": "leukodystrophy, hypomyelinating, 18", "description": "" }, { "id": "MONDO:0032730", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032730", "name": "HLD18", "description": "" }, { "id": "MONDO:0032730", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032730", "name": "LEUKODYSTROPHY, HYPOMYELINATING, 18", "description": "" }, { "id": "MIM:618404", "resource": "MIM", "url": "https://www.omim.org/entry/618404", "name": "Leukodystrophy, hypomyelinating, 18", "description": "Leukodystrophy, hypomyelinating, 18" } ], "evidence": [ { "id": "0070399", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070399" } ] }, { "disease_id": "DOID:1289", "recommended_name": { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "neurodegenerative disease", "description": "A central nervous system disease that results in the progressive deterioration of function or structure of neurons." }, "synonyms": [ { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "degenerative disease", "description": "" } ], "evidence": [ { "id": "1289", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1289" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Degs1", "url": "https://www.uniprot.org/uniprot/O09005", "locus": { "chromosome": "1", "start_pos": 182103337, "end_pos": 182110369, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038633", "url": "https://www.ensembl.org/id/ENSMUSG00000038633" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038633", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038633", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.14.19.17", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.19.17&UniProtAcc=O09005", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03508", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03508", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "13244", "url": "https://www.ncbi.nlm.nih.gov/gene/13244", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O09005", "url": "https://www.ebi.ac.uk/intact/interactors/id:O09005*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005804", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005804", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013866", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013866", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:13244", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13244", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1097711", "url": "http://www.informatics.jax.org/marker/MGI:1097711", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IWIITMM", "url": "https://omabrowser.org/oma/group/IWIITMM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5485164at2759", "url": "http://www.orthodb.org/?query=5485164at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12879", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12879", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12879:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12879:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00487", "url": "http://pfam.xfam.org/family/PF00487", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08557", "url": "http://pfam.xfam.org/family/PF08557", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O09005", "url": "http://purl.obolibrary.org/obo/PR_O09005", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1660661", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1660661", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19141", "url": "https://www.rhea-db.org/rhea/19141", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46544", "url": "https://www.rhea-db.org/rhea/46544", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "55348", "url": "https://www.rhea-db.org/rhea/55348", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "55352", "url": "https://www.rhea-db.org/rhea/55352", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "55356", "url": "https://www.rhea-db.org/rhea/55356", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "55360", "url": "https://www.rhea-db.org/rhea/55360", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F6S3U4", "url": "https://www.uniprot.org/uniprot/F6S3U4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6S3U4-1", "url": "https://www.uniprot.org/uniprot/F6S3U4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O09005-1", "url": "https://www.uniprot.org/uniprot/O09005-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFVTDDTISPYSRMKRPPKGNEILE", "length": 323, "header": "sp|O09005-1|DEGS1_MOUSE Isoform 1 of Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1 CANONICAL=O09005-1" }, "isoforms": [ { "isoform_ac": "F6S3U4-1", "url": "", "sequence": { "sequence": "MKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDF", "length": 229, "header": "tr|F6S3U4-1|DEGS1_MOUSE Computationally mapped isoform of Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=8 CANONICAL=O09005-1" }, "locus": { "chromosome": "1", "start_pos": 182107257, "end_pos": 182106571, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000133052.2", "url": "https://www.ensembl.org/id/ENSMUST00000133052.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119473.3", "url": "https://www.ensembl.org/id/ENSMUSP00000119473.3" } ] } }, { "isoform_ac": "O09005-1", "url": "", "sequence": { "sequence": "MGSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKPITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFVTDDTISPYSRMKRPPKGNEILE", "length": 323, "header": "sp|O09005-1|DEGS1_MOUSE Isoform 1 of Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1 CANONICAL=O09005-1" }, "locus": { "chromosome": "1", "start_pos": 182110268, "end_pos": 182104315, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000035295", "url": "https://www.ensembl.org/id/ENSMUST00000035295" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000048519", "url": "https://www.ensembl.org/id/ENSMUSP00000048519" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "site_lbl": "Ser307" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Identification and characterization of a sphingolipid delta 4-desaturase family.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Ternes P, Franke S, Zahringer U, Sperling P, Heinz E", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "reference": [ { "type": "PubMed", "id": "11937514", "url": "https://glygen.org/publication/PubMed/11937514" } ] }, { "title": "Specificity of the dihydroceramide desaturase inhibitor N-[(1R,2S)-2-hydroxy-1-hydroxymethyl-2-(2-tridecyl-1-cyclopropenyl)ethyl]octanami de (GT11) in primary cultured cerebellar neurons.", "journal": "Molecular pharmacology", "date": "2004", "authors": "Triola G, Fabrias G, Dragusin M, Niederhausen L, Broere R, Llebaria A, van Echten-Deckert G", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" } ], "reference": [ { "type": "PubMed", "id": "15371559", "url": "https://glygen.org/publication/PubMed/15371559" } ] }, { "title": "Identification of DES1 as a vitamin A isomerase in Mueller glial cells of the retina.", "journal": "Nat. Chem. Biol.", "date": "2013", "authors": "Kaylor JJ, Yuan Q, Cook J, Sarfare S, Makshanoff J, Miu A, Kim A, Kim P, Habib S, Roybal CN, Xu T, Nusinowitz S, Travis GH", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "reference": [ { "type": "PubMed", "id": "23143414", "url": "https://glygen.org/publication/PubMed/23143414" } ] }, { "title": "Lipidomics Suggests a New Role for Ceramide Synthase in Phagocytosis.", "journal": "ACS chemical biology", "date": "2018", "authors": "Pathak D, Mehendale N, Singh S, Mallik R, Kamat SS", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" } ], "reference": [ { "type": "PubMed", "id": "29963848", "url": "https://glygen.org/publication/PubMed/29963848" } ] }, { "title": "Conditional deletion of Des1 in the mouse retina does not impair the visual cycle in cones.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2019", "authors": "Kiser PD, Kolesnikov AV, Kiser JZ, Dong Z, Chaurasia B, Wang L, Summers SA, Hoang T, Blackshaw S, Peachey NS, Kefalov VJ, Palczewski K", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" } ], "reference": [ { "type": "PubMed", "id": "30645148", "url": "https://glygen.org/publication/PubMed/30645148" } ] }, { "title": "Targeting a ceramide double bond improves insulin resistance and hepatic steatosis.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Chaurasia B, Tippetts TS, Mayoral Monibas R, Liu J, Li Y, Wang L, Wilkerson JL, Sweeney CR, Pereira RF, Sumida DH, Maschek JA, Cox JE, Kaddai V, Lancaster GI, Siddique MM, Poss A, Pearson M, Satapati S, Zhou H, McLaren DG, Previs SF, Chen Y, Qian Y, Petrov A, Wu M, Shen X, Yao J, Nunes CN, Howard AD, Wang L, Erion MD, Rutter J, Holland WL, Kelley DE, Summers SA", "evidence": [ { "database": "RefSeq", "id": "NP_031879", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031879" } ], "reference": [ { "type": "PubMed", "id": "31273070", "url": "https://glygen.org/publication/PubMed/31273070" } ] }, { "title": "Mdes, a mouse homolog of the Drosophila degenerative spermatocyte gene is expressed during mouse spermatogenesis.", "journal": "Dev. Growth Differ.", "date": "1997", "authors": "Endo K, Matsuda Y, Kobayashi S", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "reference": [ { "type": "PubMed", "id": "9227906", "url": "https://glygen.org/publication/PubMed/9227906" } ] } ], "pathway": [ { "id": "mmu:13244", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:13244", "resource": "KEGG Pathway" }, { "id": "R-MMU-1660661", "name": "Sphingolipid de novo biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1660661", "resource": "Reactome", "description": "Sphingolipid de novo biosynthesis" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "O15121-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "DEGS1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE", "length": 323 }, "evidence": [ { "id": "45235829", "url": "http://www.informatics.jax.org/homology/45235829", "database": "MGI" }, { "id": "O09005", "url": "https://omabrowser.org/oma/group/O09005/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q5XIF5-1", "protein_name": "Sphingolipid delta(4)-desaturase DES1", "gene_name": "Degs1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGNRVSREEFEWVYTDQPHAARRQEILAKYPEIKSLMKPDPNLIWIVTSMLLVQLASFYLVKDLDWKWLMFWSYAFGSCLNHSMTLAIHEISHNFPFGHHKAMWNRWFGMFANLSLGVPYSISFKRYHMDHHRYLGADGIDVDIPTDFEGWFFCTTLRKLVWVILQPLFYAFRPLFINPKPITHLEVINTVIQVTFDVLVYYVFGVKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPLVRKIASEYYDNLPHYNSWIRVLYDFVMDDTISPYSRMKRPPKGNEIQE", "length": 323 }, "evidence": [ { "id": "45235829", "url": "http://www.informatics.jax.org/homology/45235829", "database": "MGI" }, { "id": "O09005", "url": "https://omabrowser.org/oma/group/O09005/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "ceramide biosynthetic process", "id": "GO:0046513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046513", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "fatty acid biosynthetic process", "id": "GO:0006633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006633", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "myelin maintenance", "id": "GO:0043217", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043217", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "sphingolipid delta-4 desaturase activity", "id": "GO:0042284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042284", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "retinol isomerase activity", "id": "GO:0050251", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050251", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water", "id": "GO:0016717", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016717", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 113, "end_pos": 115, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Myristoylation can target the enzyme to the mitochondria leading to an increase in ceramide levels.", "evidence": [ { "database": "UniProtKB", "id": "O09005", "url": "https://www.uniprot.org/uniprot/O09005" }, { "database": "PubMed", "id": "O15121", "url": "https://glygen.org/publication/PubMed/O15121" } ] } ], "interactions": [], "reactions": [ { "id": "19141", "name": "", "equation": "all-trans-retinol = 11-cis-retinol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XIF5-1", "O15121-1", "O09005-1" ], "evidence": [ { "id": "19141", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19141" } ] }, { "id": "46544", "name": "", "equation": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q564G3-1", "Q5XIF5-1", "Q6QHC5-1", "O15121-1", "O09005-1", "Q8R2F2-1", "Q94515-1" ], "evidence": [ { "id": "46544", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46544" } ] }, { "id": "55348", "name": "", "equation": "all-trans-retinol = 9-cis-retinol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XIF5-1", "O15121-1", "O09005-1" ], "evidence": [ { "id": "55348", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55348" } ] }, { "id": "55352", "name": "", "equation": "all-trans-retinol = 13-cis-retinol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XIF5-1", "O15121-1", "O09005-1" ], "evidence": [ { "id": "55352", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55352" } ] }, { "id": "55356", "name": "", "equation": "11-cis-retinol = 13-cis-retinol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XIF5-1", "O15121-1", "O09005-1" ], "evidence": [ { "id": "55356", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55356" } ] }, { "id": "55360", "name": "", "equation": "11-cis-retinol = 9-cis-retinol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XIF5-1", "O15121-1", "O09005-1" ], "evidence": [ { "id": "55360", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55360" } ] }, { "id": "R-MMU-428259", "name": "dihydroceramide + NAD(P)H + H+ + O2 => ceramide + NAD(P)+ + H2O", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-428126" ], "output_participant_list": [], "enzyme_list": [ "O09005-1" ], "evidence": [ { "id": "R-MMU-428259", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-428259" } ] }, { "id": "R-MMU-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64455-1", "O09005-1", "Q9Z280-1", "O35598-1", "P70704-1", "P62482-1", "B2RU80-1", "Q9Z2A7-1", "O35488-1", "A2AN08-1", "P98197-1", "Q61093-1", "O70252-1", "Q3UDW8-1", "Q80VQ0-1", "Q64277-1", "Q8K3K7-1", "Q3U435-1", "P62835-1", "O55098-1", "P61226-1", "Q05910-1", "P06869-1", "A2ANX3-1" ], "evidence": [ { "id": "R-MMU-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6799350" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-428126", "participant_name": "DHCE [endoplasmic reticulum membrane]", "crossref": [ { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" }, { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" }, { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" }, { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" }, { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" }, { "id": "31488", "database": "ChEBI", "url": "" }, { "id": "HMDB0006752", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2AN08", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] } ] }, { "uniprot_ac": "A2ANX3", "gene_name": "Atp8b4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "A2ANX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ANX3" } ] } ] }, { "uniprot_ac": "B2RU80", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] } ] }, { "uniprot_ac": "O09005", "gene_name": "Degs1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O09005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09005" } ] } ] }, { "uniprot_ac": "O15121", "gene_name": "DEGS1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] } ] }, { "uniprot_ac": "O35488", "gene_name": "Slc27a2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O35488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35488" } ] } ] }, { "uniprot_ac": "O35598", "gene_name": "Adam10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "O35598", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35598" } ] } ] }, { "uniprot_ac": "O55098", "gene_name": "Stk10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O55098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55098" } ] } ] }, { "uniprot_ac": "O70252", "gene_name": "Hmox2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "O70252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70252" } ] } ] }, { "uniprot_ac": "P06869", "gene_name": "Plau", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P06869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06869" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P62482", "gene_name": "Kcnab2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P62482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62482" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P70704", "gene_name": "Atp8a1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P70704", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70704" } ] } ] }, { "uniprot_ac": "P98197", "gene_name": "Atp11a", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P98197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98197" } ] } ] }, { "uniprot_ac": "Q05910", "gene_name": "Adam8", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q05910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05910" } ] } ] }, { "uniprot_ac": "Q3U435", "gene_name": "Mmp25", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q3U435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U435" } ] } ] }, { "uniprot_ac": "Q3UDW8", "gene_name": "Hgsnat", "activity": [ { "ec_number": "2.3.1.78", "activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] }, { "ec_number": "2.3.1.78", "activity": "", "evidence": [ { "id": "Q3UDW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UDW8" } ] } ] }, { "uniprot_ac": "Q564G3", "gene_name": "Degs2", "activity": [ { "ec_number": "1.14.18.5", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acyl-(4R)-4-hydroxysphinganine + 2 Fe(III)-[cytochrome b5] + H2O.", "evidence": [ { "id": "Q564G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q564G3" } ] }, { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q564G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q564G3" } ] }, { "ec_number": "1.14.18.5", "activity": "", "evidence": [ { "id": "Q564G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q564G3" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q564G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q564G3" } ] } ] }, { "uniprot_ac": "Q5XIF5", "gene_name": "Degs1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q5XIF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIF5" } ] } ] }, { "uniprot_ac": "Q61093", "gene_name": "Cybb", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "Q61093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61093" } ] } ] }, { "uniprot_ac": "Q64277", "gene_name": "Bst1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q64277", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64277" } ] } ] }, { "uniprot_ac": "Q64455", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] } ] }, { "uniprot_ac": "Q6QHC5", "gene_name": "DEGS2", "activity": [ { "ec_number": "1.14.18.5", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acyl-(4R)-4-hydroxysphinganine + 2 Fe(III)-[cytochrome b5] + H2O.", "evidence": [ { "id": "Q6QHC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHC5" } ] }, { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q6QHC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHC5" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q6QHC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHC5" } ] }, { "ec_number": "1.14.18.5", "activity": "", "evidence": [ { "id": "Q6QHC5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QHC5" } ] } ] }, { "uniprot_ac": "Q80VQ0", "gene_name": "Aldh3b1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "Q80VQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80VQ0" } ] } ] }, { "uniprot_ac": "Q8K3K7", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] } ] }, { "uniprot_ac": "Q8R2F2", "gene_name": "Degs2", "activity": [ { "ec_number": "1.14.18.5", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acyl-(4R)-4-hydroxysphinganine + 2 Fe(III)-[cytochrome b5] + H2O.", "evidence": [ { "id": "Q8R2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2F2" } ] }, { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q8R2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2F2" } ] }, { "ec_number": "1.14.18.5", "activity": "", "evidence": [ { "id": "Q8R2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2F2" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q8R2F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2F2" } ] } ] }, { "uniprot_ac": "Q94515", "gene_name": "ifc", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "Q94515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94515" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "Q94515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94515" } ] } ] }, { "uniprot_ac": "Q9Z280", "gene_name": "Pld1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q9Z280", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z280" } ] } ] }, { "uniprot_ac": "Q9Z2A7", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }