{ "uniprot_canonical_ac": "O08934-1", "uniprot_ac": "O08934", "uniprot_id": "UNC4_MOUSE", "mass": { "chemical_mass": 53936.0, "monoisotopic_mass": 53936.0 }, "refseq": { "ac": "NP_038730", "name": "homeobox protein unc-4 homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730" }, "gene_names": [ { "name": "Uncx", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O08934", "id": "O08934" }, { "name": "Chx4; Uncx4.1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730", "id": "NP_038730" }, { "name": "Uncx4.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O08934", "id": "O08934" }, { "name": "Uncx", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730", "id": "NP_038730" } ], "protein_names": [ { "name": "Homeobox protein unc-4 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O08934" }, { "name": "Homeobox protein Uncx4.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O08934" }, { "name": "homeobox protein Uncx4.1; Unc4.1 homeobox", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730", "id": "NP_038730" }, { "name": "homeobox protein unc-4 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730", "id": "NP_038730" } ], "function": [ { "annotation": "Transcription factor involved in somitogenesis and neurogenesis. Required for the maintenance and differentiation of particular elements of the axial skeleton. May act upstream of PAX9. Plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934#function" }, { "database": "PubMed", "id": "16461927", "url": "https://glygen.org/publication/PubMed/16461927" }, { "database": "PubMed", "id": "10804169", "url": "https://glygen.org/publication/PubMed/10804169" }, { "database": "PubMed", "id": "10804168", "url": "https://glygen.org/publication/PubMed/10804168" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Uncx", "url": "https://www.uniprot.org/uniprot/O08934", "locus": { "chromosome": "5", "start_pos": 139533934, "end_pos": 139529249, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000029546", "url": "https://www.ensembl.org/id/ENSMUSG00000029546" } ] } } ], "crossref": [ { "id": "ENSMUSG00000029546", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029546", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "22255", "url": "https://www.ncbi.nlm.nih.gov/gene/22255", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:22255", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22255", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "108013", "url": "http://www.informatics.jax.org/marker/MGI:108013", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DKDAAPC", "url": "https://omabrowser.org/oma/group/DKDAAPC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2902937at2759", "url": "http://www.orthodb.org/?query=2902937at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46799", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46799", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46799:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46799:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O08934", "url": "http://purl.obolibrary.org/obo/PR_O08934", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_038730", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038730", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O08934-1", "url": "https://www.uniprot.org/uniprot/O08934-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GXC0", "url": "https://www.uniprot.org/uniprot/V9GXC0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GXC0-1", "url": "https://www.uniprot.org/uniprot/V9GXC0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGLLSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPTAAAKGPGAHGSGIAGSAPVPPGEPPAPGTCDPAFYPSQRSGAGSQPRLGRPADKDTVPCGPGAAATAGLPKASPFSVESLLSDSPPRRKATPANAAATAGLDFTPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGPELVPKDAPPAPPAPPAPPAQASFGTFPGPGGAADPAFARRSPEVVASPGPPAPASFRDLTAAAAESGAGDCADVGTVCPAASPPPPLETSPGPGPRAPSPPGEPATCGAAEPGAATGPSPPEGEEVDMD", "length": 530, "header": "sp|O08934-1|UNC4_MOUSE Isoform 1 of Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2 CANONICAL=O08934-1" }, "isoforms": [ { "isoform_ac": "O08934-1", "url": "", "sequence": { "sequence": "MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGLLSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPTAAAKGPGAHGSGIAGSAPVPPGEPPAPGTCDPAFYPSQRSGAGSQPRLGRPADKDTVPCGPGAAATAGLPKASPFSVESLLSDSPPRRKATPANAAATAGLDFTPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGPELVPKDAPPAPPAPPAPPAQASFGTFPGPGGAADPAFARRSPEVVASPGPPAPASFRDLTAAAAESGAGDCADVGTVCPAASPPPPLETSPGPGPRAPSPPGEPATCGAAEPGAATGPSPPEGEEVDMD", "length": 530, "header": "sp|O08934-1|UNC4_MOUSE Isoform 1 of Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2 CANONICAL=O08934-1" }, "locus": { "chromosome": "5", "start_pos": 139533526, "end_pos": 139529749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000172997", "url": "https://www.ensembl.org/id/ENSMUST00000172997" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000134067", "url": "https://www.ensembl.org/id/ENSMUSP00000134067" } ] } }, { "isoform_ac": "V9GXC0-1", "url": "", "sequence": { "sequence": "MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGLLSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVKIGVAQGVRDPALGVQSAVRQGHLCSKWRGGGFRLRAAGHGGDYEG", "length": 201, "header": "tr|V9GXC0-1|V9GXC0_MOUSE Computationally mapped isoform of UNC homeobox OS=Mus musculus OX=10090 GN=Uncx PE=1 SV=2 CANONICAL=O08934-1" }, "locus": { "chromosome": "5", "start_pos": 139530526, "end_pos": 139529749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000174792.2", "url": "https://www.ensembl.org/id/ENSMUST00000174792.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139081.3", "url": "https://www.ensembl.org/id/ENSMUSP00000139081.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Interaction between Notch signalling and Lunatic fringe during somite boundary formation in the mouse.", "journal": "Curr. Biol.", "date": "1999", "authors": "Mak T.W., Gossler A., Elia A.J., de la Pompa J.L., Rossant J., Conlon R.A., De Angelis M.H., Wuensch K., del Barco Barrantes I.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "10330372", "url": "https://glygen.org/publication/PubMed/10330372" } ] }, { "title": "Adhesive subdivisions intrinsic to the epithelial somites.", "journal": "Dev. Biol.", "date": "1999", "authors": "Takeichi M., Horikawa K., Chisaka O., Radice G.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "10545229", "url": "https://glygen.org/publication/PubMed/10545229" } ] }, { "title": "Uncx4.1 is required for the formation of the pedicles and proximal ribs and acts upstream of Pax9.", "journal": "Development", "date": "2000", "authors": "Mansouri A, Voss AK, Thomas T, Yokota Y, Gruss P", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "10804168", "url": "https://glygen.org/publication/PubMed/10804168" } ] }, { "title": "The paired homeobox gene Uncx4.1 specifies pedicles, transverse processes and proximal ribs of the vertebral column.", "journal": "Development", "date": "2000", "authors": "Leitges M, Neidhardt L, Haenig B, Herrmann BG, Kispert A", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "10804169", "url": "https://glygen.org/publication/PubMed/10804169" } ] }, { "title": "Early mesodermal phenotypes in splotch suggest a role for Pax3 in the formation of epithelial somites.", "journal": "Dev. Dyn.", "date": "2001", "authors": "Gruss P., Mansouri A., Tremblay P., Lumsden A., Kammandel B., Schubert F.R., Faisst A.M., Dietrich S.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "11747084", "url": "https://glygen.org/publication/PubMed/11747084" } ] }, { "title": "Hypomorphic Mesp allele distinguishes establishment of rostrocaudal polarity and segment border formation in somitogenesis.", "journal": "Development", "date": "2002", "authors": "Nomura-Kitabayashi Aya, Takahashi Yu, Kitajima Satoshi, Inoue Tohru, Takeda Hiroyuki, Saga Yumiko", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "11973278", "url": "https://glygen.org/publication/PubMed/11973278" } ] }, { "title": "Neurohypophysial dysmorphogenesis in mice lacking the homeobox gene Uncx4.1.", "journal": "J. Mol. Endocrinol.", "date": "2006", "authors": "Mansouri A., Burbach J.P.H., Smidt M.P., van Doorninck J.H., Asbreuk C.H.J.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "16461927", "url": "https://glygen.org/publication/PubMed/16461927" } ] }, { "title": "Identification of Epha4 enhancer required for segmental expression and the regulation by Mesp2.", "journal": "Development", "date": "2006", "authors": "Nakajima Yoshiro, Morimoto Mitsuru, Takahashi Yuki, Koseki Haruhiko, Saga Yumiko", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "16728472", "url": "https://glygen.org/publication/PubMed/16728472" } ] }, { "title": "Transcription factors Mesp2 and Paraxis have critical roles in axial musculoskeletal formation.", "journal": "Dev. Dyn.", "date": "2007", "authors": "Hiraoka S., Takahashi Y., Koseki H., Saga Y., Kanno J., Takagi A., Rawls A.", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "17477400", "url": "https://glygen.org/publication/PubMed/17477400" } ] }, { "title": "Ripply2 is essential for precise somite formation during mouse early development.", "journal": "FEBS Lett.", "date": "2007", "authors": "Chan T, Kondow A, Hosoya A, Hitachi K, Yukita A, Okabayashi K, Nakamura H, Ozawa H, Kiyonari H, Michiue T, Ito Y, Asashima M", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "17531978", "url": "https://glygen.org/publication/PubMed/17531978" } ] }, { "title": "Cloning and characterization of four murine homeobox genes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Rovescalli AC, Asoh S, Nirenberg M", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "8855241", "url": "https://glygen.org/publication/PubMed/8855241" } ] }, { "title": "Paired-related murine homeobox gene expressed in the developing sclerotome, kidney, and nervous system.", "journal": "Dev. Dyn.", "date": "1997", "authors": "Mansouri A, Yokota Y, Wehr R, Copeland NG, Jenkins NA, Gruss P", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "reference": [ { "type": "PubMed", "id": "9286595", "url": "https://glygen.org/publication/PubMed/9286595" } ] } ], "pathway": [ { "id": "mmu:22255", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22255", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6NJT0-1", "protein_name": "Homeobox protein unc-4 homolog", "gene_name": "UNCX", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAASVPFSIDGLLGGSCAAAASVVNPTPLLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQGRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPAAKGPGAHASGAAGTAPAPPGEPPAPGTCDPAFYPSQRSGAGPQPRPGRPADKDAASCGPGAAVAAVERGAAGLPKASPFSVESLLSDSPPRRKAASNAAAAAAAGLDFAPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGLEPAPKDAPPAPAVPPAPPAQASFGAFSGPGGAPDSAFARRSPDAVASPGAPAPAPAPFRDLASAAATEGGGGDCADAGTAGPAPPPPAPSPRPGPRPPSPAEEPATCGVPEPGAAAGPSPPEGEELDMD", "length": 531 }, "evidence": [ { "id": "45227138", "url": "http://www.informatics.jax.org/homology/45227138", "database": "MGI" }, { "id": "O08934", "url": "https://omabrowser.org/oma/group/O08934/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P97830-1", "protein_name": "Homeobox protein unc-4 homolog", "gene_name": "Uncx", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGLLSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALAVRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSDSGGGGLSPEPPEPPPPTASAKGPGAHGSGIAGSAPVPPGEPPAPGTCDPAFYPSQRSGAGSQPRLGRPADKDTVPCGPGAASTAGLPKASPFSVESLLSDSPPRRKATPANTAATAGLDFTPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGPELVPKDAPPAPPAPPAPPAQASFGAFPGPVGAADPAFARRSPEVVASPGPPAPASFRGLAAAAAESGAGDCADAGTVCPAAPPPPPLETSPGPGPRAPSPPGEPATCGAAEPGAATGSSPPEGEEVDMD", "length": 530 }, "evidence": [ { "id": "45227138", "url": "http://www.informatics.jax.org/homology/45227138", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "dorsal spinal cord development", "id": "GO:0021516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021516", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "regulation of cell differentiation", "id": "GO:0045595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045595", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "cartilage condensation", "id": "GO:0001502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001502", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "pattern specification process", "id": "GO:0007389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007389", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "common myeloid progenitor cell proliferation", "id": "GO:0035726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035726", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" }, { "name": "olfactory bulb interneuron differentiation", "id": "GO:0021889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021889", "evidence": [ { "database": "UniProtKB", "id": "O08934", "url": "https://www.uniprot.org/uniprot/O08934" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 115, "end_pos": 117, "annotation": "n_glycosylation_sequon" }, { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }