{
    "uniprot_canonical_ac": "O08707-1",
    "uniprot_ac": "O08707",
    "uniprot_id": "ACKR2_MOUSE",
    "mass": {
        "chemical_mass": 43207.0,
        "monoisotopic_mass": 43207.0
    },
    "refseq": {
        "ac": "NP_001263648",
        "name": "atypical chemokine receptor 2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
    },
    "gene_names": [
        {
            "name": "Ackr2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O08707",
            "id": "O08707"
        },
        {
            "name": "Ackr2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648",
            "id": "NP_001263648"
        },
        {
            "name": "Ccbp2; CCR10; CCR9; Cmkbr9; D6",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648",
            "id": "NP_001263648"
        },
        {
            "name": "Ccbp2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O08707",
            "id": "O08707"
        },
        {
            "name": "D6",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O08707",
            "id": "O08707"
        }
    ],
    "protein_names": [
        {
            "name": "Atypical chemokine receptor 2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O08707"
        },
        {
            "name": "C-C chemokine receptor D6",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O08707"
        },
        {
            "name": "Chemokine-binding protein 2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O08707"
        },
        {
            "name": "Chemokine-binding protein D6",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O08707"
        },
        {
            "name": "atypical chemokine receptor 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648",
            "id": "NP_001263648"
        },
        {
            "name": "chemokine-binding protein 2; C-C chemokine receptor D6; chemokine decoy receptor D6; chemokine-binding protein D6; D6 beta-chemokine receptor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648",
            "id": "NP_001263648"
        }
    ],
    "function": [
        {
            "annotation": "ACKR2 dampens CCL5 levels and the consequent recruitment of CCR5(+) T helper 1 (Th1).",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "31995405",
                    "url": "https://glygen.org/publication/PubMed/31995405"
                }
            ]
        },
        {
            "annotation": "ACKR2 limits skin fibrosis and hair loss through IFN-beta.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "34533865",
                    "url": "https://glygen.org/publication/PubMed/34533865"
                }
            ]
        },
        {
            "annotation": "Analysis of lung stromal expression of the atypical chemokine receptor ACKR2 reveals unanticipated expression in murine blood endothelial cells.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "32114694",
                    "url": "https://glygen.org/publication/PubMed/32114694"
                }
            ]
        },
        {
            "annotation": "Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3. Upon active ligand stimulation, activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling pathway. Activation of this pathway results in up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in placenta, plays an essential role in the resolution (termination) of the inflammatory response and in the regulation of adaptive immune responses. Plays a major role in the immune silencing of macrophages during the resolution of inflammation. Acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is required for immature/mature dendritic cells discrimination by LECs.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O08707",
                    "url": "https://www.uniprot.org/uniprot/O08707#function"
                },
                {
                    "database": "PubMed",
                    "id": "22651933",
                    "url": "https://glygen.org/publication/PubMed/22651933"
                }
            ]
        },
        {
            "annotation": "CCR10 engagement by locally produced CCL27 allows melanoma cells to escape host immune antitumor killing mechanisms (possibly through activation of PI3K/Akt), thereby providing a means for tumor progression",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "14581607",
                    "url": "https://glygen.org/publication/PubMed/14581607"
                }
            ]
        },
        {
            "annotation": "CCR9-deficient IgA+ plasma cells show reduced migration into the small intestine compared with wild-type controls.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "14744993",
                    "url": "https://glygen.org/publication/PubMed/14744993"
                }
            ]
        },
        {
            "annotation": "The atypical chemokine receptor-2 fine-tunes the immune response in herpes stromal keratitis. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "36518752",
                    "url": "https://glygen.org/publication/PubMed/36518752"
                }
            ]
        },
        {
            "annotation": "The chemokine receptor D6 limits the inflammatory response in vivo.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                },
                {
                    "database": "PubMed",
                    "id": "15750596",
                    "url": "https://glygen.org/publication/PubMed/15750596"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O08707",
                    "url": "https://www.uniprot.org/uniprot/O08707"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Ackr2",
            "url": "https://www.uniprot.org/uniprot/O08707",
            "locus": {
                "chromosome": "9",
                "start_pos": 121740140,
                "end_pos": 121727421,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000044534",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000044534"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000044534",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000044534",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "59289",
            "url": "https://www.ncbi.nlm.nih.gov/gene/59289",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000355",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000355",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001277",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001277",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:59289",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:59289",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1891697",
            "url": "http://www.informatics.jax.org/marker/MGI:1891697",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IVHAQPH",
            "url": "https://omabrowser.org/oma/group/IVHAQPH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5350443at2759",
            "url": "http://www.orthodb.org/?query=5350443at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10489",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10489:SF942",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489:SF942",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00001",
            "url": "http://pfam.xfam.org/family/PF00001",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_O08707",
            "url": "http://purl.obolibrary.org/obo/PR_O08707",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-380108",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380108",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001263648",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1ST82",
            "url": "https://www.uniprot.org/uniprot/A0A1L1ST82",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1ST82-1",
            "url": "https://www.uniprot.org/uniprot/A0A1L1ST82-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1SV85",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SV85",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1SV85-1",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SV85-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O08707",
            "url": "https://www.uniprot.org/uniprot/O08707",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O08707-1",
            "url": "https://www.uniprot.org/uniprot/O08707-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGLAGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVISTLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMVFVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLRPPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLAFSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMNDLGERQSEDSLNKGEMGNT",
        "length": 378,
        "header": "sp|O08707-1|ACKR2_MOUSE Isoform 1 of Atypical chemokine receptor 2  OS=Mus musculus OX=10090 GN=Ackr2 PE=1 SV=2 CANONICAL=O08707-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1L1ST82-1",
            "url": "",
            "sequence": {
                "sequence": "MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGLAGNLLLL",
                "length": 67,
                "header": "tr|A0A1L1ST82-1|A0A1L1ST82_MOUSE Computationally mapped isoform of Atypical chemokine receptor 2  OS=Mus musculus OX=10090 GN=Ackr2 PE=4 SV=1 CANONICAL=O08707-1"
            },
            "locus": {
                "chromosome": "9",
                "start_pos": 121737827,
                "end_pos": 121737627,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000216326.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000216326.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000150219.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000150219.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A1L1SV85-1",
            "url": "",
            "sequence": {
                "sequence": "MPTVASPLPLTTVGSENSSSIYDYDYL",
                "length": 27,
                "header": "tr|A0A1L1SV85-1|A0A1L1SV85_MOUSE Computationally mapped isoform of Atypical chemokine receptor 2  OS=Mus musculus OX=10090 GN=Ackr2 PE=4 SV=1 CANONICAL=O08707-1"
            },
            "locus": {
                "chromosome": "9",
                "start_pos": 121737707,
                "end_pos": 121737627,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000215664.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000215664.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000151092.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000151092.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "O08707-1",
            "url": "",
            "sequence": {
                "sequence": "MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGLAGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVISTLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMVFVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLRPPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLAFSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMNDLGERQSEDSLNKGEMGNT",
                "length": 378,
                "header": "sp|O08707-1|ACKR2_MOUSE Isoform 1 of Atypical chemokine receptor 2  OS=Mus musculus OX=10090 GN=Ackr2 PE=1 SV=2 CANONICAL=O08707-1"
            },
            "locus": {
                "chromosome": "9",
                "start_pos": 121738760,
                "end_pos": 121737627,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000214340",
                        "url": "https://www.ensembl.org/id/ENSMUST00000214340"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000148966",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000148966"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 17,
            "start_aa": "Asn",
            "end_pos": 17,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn17",
            "evidence": [
                {
                    "id": "O08707",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/O08707#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Immune evasion by murine melanoma mediated through CC chemokine receptor-10.",
            "journal": "The Journal of experimental medicine",
            "date": "2003",
            "authors": "Murakami T, Cardones AR, Finkelstein SE, Restifo NP, Klaunberg BA, Nestle FO, Castillo SS, Dennis PA, Hwang ST",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14581607",
                    "url": "https://glygen.org/publication/PubMed/14581607"
                }
            ]
        },
        {
            "title": "Chemokine receptor CCR9 contributes to the localization of plasma cells to the small intestine.",
            "journal": "The Journal of experimental medicine",
            "date": "2004",
            "authors": "Pabst O, Ohl L, Wendland M, Wurbel MA, Kremmer E, Malissen B, Forster R",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14744993",
                    "url": "https://glygen.org/publication/PubMed/14744993"
                }
            ]
        },
        {
            "title": "The chemokine receptor D6 limits the inflammatory response in vivo.",
            "journal": "Nature immunology",
            "date": "2005",
            "authors": "Jamieson T, Cook DN, Nibbs RJ, Rot A, Nixon C, McLean P, Alcami A, Lira SA, Wiekowski M, Graham GJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15750596",
                    "url": "https://glygen.org/publication/PubMed/15750596"
                }
            ]
        },
        {
            "title": "The atypical chemokine receptor D6 controls macrophage efferocytosis and cytokine secretion during the resolution of inflammation.",
            "journal": "FASEB J.",
            "date": "2012",
            "authors": "Ariel A., Aswad M., Pashover-Schallinger E., Schif-Zuck S., Shapiro H., Singer P.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O08707",
                    "url": "https://www.uniprot.org/uniprot/O08707"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22651933",
                    "url": "https://glygen.org/publication/PubMed/22651933"
                }
            ]
        },
        {
            "title": "Regulation of the immune and inflammatory responses by the 'atypical' chemokine receptor D6.",
            "journal": "J. Pathol.",
            "date": "2013",
            "authors": "Graham G.J., Locati M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O08707",
                    "url": "https://www.uniprot.org/uniprot/O08707"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23125030",
                    "url": "https://glygen.org/publication/PubMed/23125030"
                }
            ]
        },
        {
            "title": "ACKR2 contributes to pulmonary dysfunction by shaping CCL5:CCR5-dependent recruitment of lymphocytes during influenza A infection in mice.",
            "journal": "American journal of physiology. Lung cellular and molecular physiology",
            "date": "2020",
            "authors": "Tavares LP, Garcia CC, Goncalves APF, Kraemer LR, Melo EM, Oliveira FMS, Freitas CS, Lopes GAO, Reis DC, Cassali GD, Machado AM, Mantovani A, Locati M, Teixeira MM, Russo RC",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31995405",
                    "url": "https://glygen.org/publication/PubMed/31995405"
                }
            ]
        },
        {
            "title": "Analysis of lung stromal expression of the atypical chemokine receptor ACKR2 reveals unanticipated expression in murine blood endothelial cells.",
            "journal": "European journal of immunology",
            "date": "2020",
            "authors": "Hansell CAH, Love S, Pingen M, Wilson GJ, MacLeod M, Graham GJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32114694",
                    "url": "https://glygen.org/publication/PubMed/32114694"
                }
            ]
        },
        {
            "title": "ACKR2 limits skin fibrosis and hair loss through IFN-beta.",
            "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
            "date": "2021",
            "authors": "Butenko S, Ben Jashar N, Sheffer T, Sabo E, Schif-Zuck S, Ariel A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34533865",
                    "url": "https://glygen.org/publication/PubMed/34533865"
                }
            ]
        },
        {
            "title": "The atypical chemokine receptor-2 fine-tunes the immune response in herpes stromal keratitis.",
            "journal": "Frontiers in immunology",
            "date": "2022",
            "authors": "Yu Tian, Schuette Fabian, Christofi Maria, Forrester John V, Graham Gerard J, Kuffova Lucia",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001263648",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263648"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36518752",
                    "url": "https://glygen.org/publication/PubMed/36518752"
                }
            ]
        },
        {
            "title": "Cloning and characterization of a novel murine beta chemokine receptor, D6. Comparison to three other related macrophage inflammatory protein-1alpha receptors, CCR-1, CCR-3, and CCR-5.",
            "journal": "J. Biol. Chem.",
            "date": "1997",
            "authors": "Nibbs RJ, Wylie SM, Pragnell IB, Graham GJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O08707",
                    "url": "https://www.uniprot.org/uniprot/O08707"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9139699",
                    "url": "https://glygen.org/publication/PubMed/9139699"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:59289",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:59289",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-380108",
            "name": "Chemokine receptors bind chemokines",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380108",
            "resource": "Reactome",
            "description": "Chemokine receptors bind chemokines"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O00590-1",
            "protein_name": "Atypical chemokine receptor 2",
            "gene_name": "ACKR2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA",
                "length": 384
            },
            "evidence": [
                {
                    "id": "45240255",
                    "url": "http://www.informatics.jax.org/homology/45240255",
                    "database": "MGI"
                },
                {
                    "id": "O08707",
                    "url": "https://omabrowser.org/oma/group/O08707/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "O09027-1",
            "protein_name": "Atypical chemokine receptor 2",
            "gene_name": "Ackr2",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MPTIASPLPLATTGPENGSSIYDYDYLDDVTVLVCSKDEVLSFGRVFLPVVYSLIFVLGLAGNLLLLVVLLHSVPQRRRMIELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVVSTLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKTRFRNLLLIVMVWITALAVSVPEMVFVKVHQTLDGVWHCYADFGGHATIWKLYLRFQMNLLGFLFPLLAMIFFYSRIGCVLVRLRPPGQGRALRMAAALVVVFFLLWFPYNLTLFLHSLLDLHVFGNCKISHRLDYMLQVTESLAFSHCCFTPVLYAFSSHSFRQYLKAVLSVVLRRHQAPGTAHAPPCSHSESSRVTAQEDVVSMNDLGERQADISLNKGEIGNN",
                "length": 382
            },
            "evidence": [
                {
                    "id": "45240255",
                    "url": "http://www.informatics.jax.org/homology/45240255",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 4,
                "go_terms": [
                    {
                        "name": "chemokine receptor activity",
                        "id": "GO:0004950",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004950",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "scavenger receptor activity",
                        "id": "GO:0005044",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005044",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "C-C chemokine receptor activity",
                        "id": "GO:0016493",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016493",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "C-C chemokine binding",
                        "id": "GO:0019957",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019957",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 10,
                "go_terms": [
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "early endosome",
                        "id": "GO:0005769",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "actin filament",
                        "id": "GO:0005884",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005884",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nuclear membrane",
                        "id": "GO:0031965",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "intracellular membrane-bounded organelle",
                        "id": "GO:0043231",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "recycling endosome",
                        "id": "GO:0055037",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "external side of plasma membrane",
                        "id": "GO:0009897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 6,
                "go_terms": [
                    {
                        "name": "inflammatory response",
                        "id": "GO:0006954",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "immune response",
                        "id": "GO:0006955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction",
                        "id": "GO:0007165",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cytosolic calcium ion concentration",
                        "id": "GO:0007204",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "calcium-mediated signaling",
                        "id": "GO:0019722",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell chemotaxis",
                        "id": "GO:0060326",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O08707",
                                "url": "https://www.uniprot.org/uniprot/O08707"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 17,
            "end_pos": 19,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 266,
            "end_pos": 268,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 342,
            "end_pos": 344,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 10
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}