{ "uniprot_canonical_ac": "O01666-1", "uniprot_ac": "O01666", "uniprot_id": "ATPG_DROME", "mass": { "chemical_mass": 32871.0, "monoisotopic_mass": 32871.0 }, "refseq": { "ac": "NP_524550", "name": "ATP synthase, gamma subunit, isoform A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550" }, "gene_names": [ { "name": "ATPsyngamma", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O01666", "id": "O01666" }, { "name": "ATP-syn-gamma; ATPG; ATPG_DROME; ATPsyn-gam; ATPsyn-gamma; CG7610; Dmel\\CG7610", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550", "id": "NP_524550" }, { "name": "ATPsyn-gamma", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O01666", "id": "O01666" }, { "name": "ATPsyngamma", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550", "id": "NP_524550" }, { "name": "CG7610", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O01666", "id": "O01666" } ], "protein_names": [ { "name": "ATP synthase subunit gamma, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O01666" }, { "name": "ATP synthase, gamma subunit, isoform A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550", "id": "NP_524550" }, { "name": "CG7610-PA; ATPsyngamma-PA; ATPsyn-gamma chain; ATP synthase subunit gamma; F0/F1 ATP synthase gamma; F1ATP synthase; catalytic core of F1 ATP synthase of complex V; ATP synthase-gamma chain; ATP synthase gamma chain; ATPsynthase gamma", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550", "id": "NP_524550" }, { "name": "F-ATPase gamma subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O01666" } ], "function": [ { "annotation": "Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666#function" } ] } ], "disease": [ { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "ATPsyngamma", "url": "https://www.uniprot.org/uniprot/O01666", "locus": { "chromosome": "3R", "start_pos": 29747704, "end_pos": 29749163, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0020235", "url": "https://www.ensembl.org/id/FBgn0020235" } ] } } ], "crossref": [ { "id": "FBgn0020235", "url": "https://bgee.org/?page=gene&gene_id=FBgn0020235", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12151", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12151", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0020235", "url": "https://flybase.org/reports/FBgn0020235", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "43507", "url": "https://www.ncbi.nlm.nih.gov/gene/43507", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "O01666", "url": "https://www.ebi.ac.uk/intact/interactors/id:O01666*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000131", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000131", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023632", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023632", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035968", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035968", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG7610", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7610", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MQITSAM", "url": "https://omabrowser.org/oma/group/MQITSAM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "393at2759", "url": "http://www.orthodb.org/?query=393at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11693", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11693", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11693:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11693:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00231", "url": "http://pfam.xfam.org/family/PF00231", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O01666", "url": "http://purl.obolibrary.org/obo/PR_O01666", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-163210", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-163210", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-8949613", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8949613", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_524550", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524550", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O01666-1", "url": "https://www.uniprot.org/uniprot/O01666-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMMQRTQLLLPLAMEATMLAQQQRGMATLKMISIRLKSVKNIQKITQSMKMVSAAKYARAERDLKAARPYGIGAQQFFEKTEIQPDEKAEPKKLLIAVTSDRGLCGAVHTGVARLIRGELAQDEANTKVFCVGDKSRAILSRLYGKNILMVANEVGRLPPTFLDASKIANEVLQTGYDYTEGKIVYNRFKSVVSYQCSTLPIFSGSTVEKSEKLAVYDSLDSDVVKSYLEFSLASLIFYTMKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELIEIISGAAALT", "length": 297, "header": "sp|O01666-1|ATPG_DROME Isoform 1 of ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsyngamma PE=2 SV=2 CANONICAL=O01666-1" }, "isoforms": [ { "isoform_ac": "O01666-1", "url": "", "sequence": { "sequence": "MMMQRTQLLLPLAMEATMLAQQQRGMATLKMISIRLKSVKNIQKITQSMKMVSAAKYARAERDLKAARPYGIGAQQFFEKTEIQPDEKAEPKKLLIAVTSDRGLCGAVHTGVARLIRGELAQDEANTKVFCVGDKSRAILSRLYGKNILMVANEVGRLPPTFLDASKIANEVLQTGYDYTEGKIVYNRFKSVVSYQCSTLPIFSGSTVEKSEKLAVYDSLDSDVVKSYLEFSLASLIFYTMKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELIEIISGAAALT", "length": 297, "header": "sp|O01666-1|ATPG_DROME Isoform 1 of ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsyngamma PE=2 SV=2 CANONICAL=O01666-1" }, "locus": { "chromosome": "3R", "start_pos": 29748747, "end_pos": 29747857, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0085539", "url": "https://www.ensembl.org/id/FBtr0085539" }, { "database": "Ensembl Peptide", "id": "FBpp0084905", "url": "https://www.ensembl.org/id/FBpp0084905" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of nuclear genes encoding mitochondrial proteins: isolation of a collection of D. melanogaster cDNAs homologous to sequences in the Human Gene Index database.", "journal": "Mol. Gen. Genet.", "date": "1999", "authors": "Barsanti P., Caggese C., Caizzi R., Moschetti R., Perrini B., Ragone G., de Pinto V.", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "reference": [ { "type": "PubMed", "id": "10071211", "url": "https://glygen.org/publication/PubMed/10071211" } ] }, { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] } ], "pathway": [ { "id": "dme:Dmel_CG7610", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG7610", "resource": "KEGG Pathway" }, { "id": "R-DME-163210", "name": "Formation of ATP by chemiosmotic coupling", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-163210", "resource": "Reactome", "description": "Formation of ATP by chemiosmotic coupling" }, { "id": "R-DME-8949613", "name": "Cristae formation", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8949613", "resource": "Reactome", "description": "Cristae formation" } ], "orthologs": [ { "uniprot_canonical_ac": "P36542-1", "protein_name": "ATP synthase subunit gamma, mitochondrial", "gene_name": "ATP5F1C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD", "length": 298 }, "evidence": [ { "id": "O01666", "url": "https://omabrowser.org/oma/group/O01666/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P38077-1", "protein_name": "ATP synthase subunit gamma, mitochondrial", "gene_name": "ATP3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MLSRIVSNNATRSVMCHQAQVGILYKTNPVRTYATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG", "length": 311 }, "evidence": [ { "id": "O01666", "url": "https://omabrowser.org/oma/group/O01666/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q91VR2-1", "protein_name": "ATP synthase subunit gamma, mitochondrial", "gene_name": "Atp5f1c", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFSRASVVGLSACAVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGTGSLALYEKADIKAPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKNEVAALTAAGKEVMIVGVGEKIKGILYRTHSDQFLVSFKDVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNQFKSVISYKTEEKPIFSLNTIATAETMSIYDDIDADVLQNYQEYNLANLIYYSLKESTTSEQSARMTAMDNASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAALD", "length": 298 }, "evidence": [ { "id": "O01666", "url": "https://omabrowser.org/oma/group/O01666/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "pmid": "" }, { "name": "mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)", "id": "GO:0000275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000275", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "pmid": "" }, { "name": "mitochondrial proton-transporting ATP synthase, central stalk", "id": "GO:0005756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005756", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proton motive force-driven ATP synthesis", "id": "GO:0015986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015986", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "proton-transporting ATP synthase activity, rotational mechanism", "id": "GO:0046933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046933", "evidence": [ { "database": "UniProtKB", "id": "O01666", "url": "https://www.uniprot.org/uniprot/O01666" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 258, "end_pos": 260, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }