{ "uniprot_canonical_ac": "O00626-1", "uniprot_ac": "O00626", "uniprot_id": "CCL22_HUMAN", "mass": { "chemical_mass": 10625.0, "monoisotopic_mass": 10625.0 }, "refseq": { "ac": "NP_002981", "name": "C-C motif chemokine 22 precursor", "summary": "This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, "gene_names": [ { "name": "CCL22", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O00626", "id": "O00626" }, { "name": "A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981", "id": "NP_002981" }, { "name": "A-152E5.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00626", "id": "O00626" }, { "name": "CCL22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981", "id": "NP_002981" }, { "name": "MDC", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00626", "id": "O00626" }, { "name": "SCYA22", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O00626", "id": "O00626" } ], "protein_names": [ { "name": "C-C motif chemokine 22", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O00626" }, { "name": "C-C motif chemokine 22 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981", "id": "NP_002981" }, { "name": "CC chemokine STCP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00626" }, { "name": "MDC(1-69)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00626" }, { "name": "Macrophage-derived chemokine", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00626" }, { "name": "Small-inducible cytokine A22", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00626" }, { "name": "Stimulated T-cell chemotactic protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O00626" }, { "name": "small inducible cytokine subfamily A (Cys-Cys), member 22; macrophage-derived chemokine; chemokine (C-C motif) ligand 22; stimulated T cell chemotactic protein 1; CC chemokine STCP-1; small inducible cytokine A22; C-C motif chemokine 22; MDC(1-69)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981", "id": "NP_002981" } ], "function": [ { "annotation": "CCL17 and CCL22 chemokines are upregulated in human obesity and play a role in vascular dysfunction. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "37124725", "url": "https://glygen.org/publication/PubMed/37124725" } ] }, { "annotation": "CCL22 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus.", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "12949249", "url": "https://glygen.org/publication/PubMed/12949249" } ] }, { "annotation": "Macrophage-Derived Chemokine MDC/CCL22: An Ambiguous Finding in COVID-19. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "37685890", "url": "https://glygen.org/publication/PubMed/37685890" } ] }, { "annotation": "May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626#function" } ] }, { "annotation": "Spatial Transcriptomics Analysis Reveals that CCL17 and CCL22 are Robust Indicators of a Suppressive Immune Environment in Angioimmunoblastic T Cell Lymphoma (AITL).", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "36224014", "url": "https://glygen.org/publication/PubMed/36224014" } ] }, { "annotation": "This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ] }, { "annotation": "Toxoplasma gondii GRA28 Is Required for Placenta-Specific Induction of the Regulatory Chemokine CCL22 in Human and Mouse.", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "34781732", "url": "https://glygen.org/publication/PubMed/34781732" } ] }, { "annotation": "Tumor-associated macrophage (TAM)-derived CCL22 induces FAK addiction in esophageal squamous cell carcinoma (ESCC).", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" }, { "database": "PubMed", "id": "35962191", "url": "https://glygen.org/publication/PubMed/35962191" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "53.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "63.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "57.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "84.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "50.48", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "73.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "67.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "51.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "44.24", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "65.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "51.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "48.68", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "58.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O00626", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O00626" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "common_name": "Human" } ], "gene": [ { "name": "CCL22", "url": "https://www.uniprot.org/uniprot/O00626", "locus": { "chromosome": "16", "start_pos": 57366189, "end_pos": 57358783, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000102962", "url": "https://www.ensembl.org/id/ENSG00000102962" } ] } } ], "crossref": [ { "id": "ENSG00000102962", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102962", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00272", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00272", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295649", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295649", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CCL22", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CCL22", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "6367", "url": "https://www.ncbi.nlm.nih.gov/gene/6367", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10621", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10621", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O00626", "url": "https://www.ebi.ac.uk/intact/interactors/id:O00626*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6367", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6367", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602957", "url": "http://www.omim.org/entry/602957", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O00626", "url": "https://www.nextprot.org/entry/NX_O00626", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "RDYIRHP", "url": "https://omabrowser.org/oma/group/RDYIRHP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4265193at2759", "url": "http://www.orthodb.org/?query=4265193at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015:SF102", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015:SF102", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00048", "url": "http://pfam.xfam.org/family/PF00048", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O00626", "url": "https://pharos.nih.gov/targets/O00626", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O00626", "url": "http://purl.obolibrary.org/obo/PR_O00626", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O00626-1", "url": "https://www.uniprot.org/uniprot/O00626-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ", "length": 93, "header": "sp|O00626-1|CCL22_HUMAN Isoform 1 of C-C motif chemokine 22 OS=Homo sapiens OX=9606 GN=CCL22 PE=1 SV=2 CANONICAL=O00626-1" }, "isoforms": [ { "isoform_ac": "O00626-1", "url": "", "sequence": { "sequence": "MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ", "length": 93, "header": "sp|O00626-1|CCL22_HUMAN Isoform 1 of C-C motif chemokine 22 OS=Homo sapiens OX=9606 GN=CCL22 PE=1 SV=2 CANONICAL=O00626-1" }, "locus": { "chromosome": "16", "start_pos": 57363585, "end_pos": 57358817, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000219235.5", "url": "https://www.ensembl.org/id/ENST00000219235.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000219235.4", "url": "https://www.ensembl.org/id/ENSP00000219235.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Modulation of formyl peptide receptor expression by IL-10 in human monocytes and neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Thivierge M, Parent JL, Stankova J, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10092818", "url": "https://glygen.org/publication/PubMed/10092818" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Zaballos A, Gutierrez J, Varona R, Ardavin C, Marquez G", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10229797", "url": "https://glygen.org/publication/PubMed/10229797" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Regulation of macrophage chemokine expression by lipopolysaccharide in vitro and in vivo.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kopydlowski KM, Salkowski CA, Cody MJ, van Rooijen N, Major J, Hamilton TA, Vogel SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10415057", "url": "https://glygen.org/publication/PubMed/10415057" } ] }, { "title": "The interleukin-10 signal transduction pathway and regulation of gene expression in mononuclear phagocytes.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "1999", "authors": "Donnelly RP, Dickensheets H, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10433356", "url": "https://glygen.org/publication/PubMed/10433356" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "CCR9A and CCR9B: two receptors for the chemokine CCL25/TECK/Ck beta-15 that differ in their sensitivities to ligand.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Yu CR, Peden KW, Zaitseva MB, Golding H, Farber JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10640743", "url": "https://glygen.org/publication/PubMed/10640743" } ] }, { "title": "Cutting edge: identification of a novel chemokine receptor that binds dendritic cell- and T cell-active chemokines including ELC, SLC, and TECK.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Gosling J, Dairaghi DJ, Wang Y, Hanley M, Talbot D, Miao Z, Schall TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10706668", "url": "https://glygen.org/publication/PubMed/10706668" } ] }, { "title": "Cutting edge: identification of the orphan receptor G-protein-coupled receptor 2 as CCR10, a specific receptor for the chemokine ESkine.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Jarmin DI, Rits M, Bota D, Gerard NP, Graham GJ, Clark-Lewis I, Gerard C", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10725696", "url": "https://glygen.org/publication/PubMed/10725696" } ] }, { "title": "Cutting edge: the orphan chemokine receptor G protein-coupled receptor-2 (GPR-2, CCR10) binds the skin-associated chemokine CCL27 (CTACK/ALP/ILC).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Homey B, Wang W, Soto H, Buchanan ME, Wiesenborn A, Catron D, Muller A, McClanahan TK, Dieu-Nosjean MC, Orozco R, Ruzicka T, Lehmann P, Oldham E, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10725697", "url": "https://glygen.org/publication/PubMed/10725697" } ] }, { "title": "Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2).", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Wang W, Soto H, Oldham ER, Buchanan ME, Homey B, Catron D, Jenkins N, Copeland NG, Gilbert DJ, Nguyen N, Abrams J, Kershenovich D, Smith K, McClanahan T, Vicari AP, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "10781587", "url": "https://glygen.org/publication/PubMed/10781587" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "Molecular cloning of a novel scavenger receptor for oxidized low density lipoprotein, SR-PSOX, on macrophages.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Shimaoka T, Kume N, Minami M, Hayashida K, Kataoka H, Kita T, Yonehara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "11060282", "url": "https://glygen.org/publication/PubMed/11060282" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Dendritic cells as a major source of macrophage-derived chemokine/CCL22 in vitro and in vivo.", "journal": "Eur. J. Immunol.", "date": "2001", "authors": "Vulcano M, Albanesi C, Stoppacciaro A, Bagnati R, D'Amico G, Struyf S, Transidico P, Bonecchi R, Del Prete A, Allavena P, Ruco LP, Chiabrando C, Girolomoni G, Mantovani A, Sozzani S", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "reference": [ { "type": "PubMed", "id": "11241286", "url": "https://glygen.org/publication/PubMed/11241286" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hoover DM, Boulegue C, Yang D, Oppenheim JJ, Tucker K, Lu W, Lubkowski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "12149255", "url": "https://glygen.org/publication/PubMed/12149255" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "A highly selective CCR2 chemokine agonist encoded by human herpesvirus 6.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Luttichau HR, Clark-Lewis I, Jensen PO, Moser C, Gerstoft J, Schwartz TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "12554737", "url": "https://glygen.org/publication/PubMed/12554737" } ] }, { "title": "New microRNAs from mouse and human.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Lagos-Quintana M, Rauhut R, Meyer J, Borkhardt A, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12554859", "url": "https://glygen.org/publication/PubMed/12554859" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Activation of STAT3 by IL-6 and IL-10 in primary human macrophages is differentially modulated by suppressor of cytokine signaling 3.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Niemand C, Nimmesgern A, Haan S, Fischer P, Schaper F, Rossaint R, Heinrich PC, Muller-Newen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12626585", "url": "https://glygen.org/publication/PubMed/12626585" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "CCR3 functional responses are regulated by both CXCR3 and its ligands CXCL9, CXCL10 and CXCL11.", "journal": "European journal of immunology", "date": "2003", "authors": "Xanthou G, Duchesnes CE, Williams TJ, Pease JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "12884299", "url": "https://glygen.org/publication/PubMed/12884299" } ] }, { "title": "Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.", "journal": "Journal of leukocyte biology", "date": "2003", "authors": "Yang D, Chen Q, Hoover DM, Staley P, Tucker KD, Lubkowski J, Oppenheim JJ", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "12949249", "url": "https://glygen.org/publication/PubMed/12949249" } ] }, { "title": "IL-10 stimulates monocyte Fc gamma R surface expression and cytotoxic activity. Distinct regulation of antibody-dependent cellular cytotoxicity by IFN-gamma, IL-4, and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "te Velde AA, de Waal Malefijt R, Huijbens RJ, de Vries JE, Figdor CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1460289", "url": "https://glygen.org/publication/PubMed/1460289" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Differential recognition and scavenging of native and truncated macrophage-derived chemokine (macrophage-derived chemokine/CC chemokine ligand 22) by the D6 decoy receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Bonecchi R, Locati M, Galliera E, Vulcano M, Sironi M, Fra AM, Gobbi M, Vecchi A, Sozzani S, Haribabu B, Van Damme J, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "15067078", "url": "https://glygen.org/publication/PubMed/15067078" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "STAT3 nuclear import is independent of tyrosine phosphorylation and mediated by importin-alpha3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Liu L, McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "15919823", "url": "https://glygen.org/publication/PubMed/15919823" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "The chemokine SDF-1/CXCL12 binds to and signals through the orphan receptor RDC1 in T lymphocytes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Balabanian K, Lagane B, Infantino S, Chow KY, Harriague J, Moepps B, Arenzana-Seisdedos F, Thelen M, Bachelerie F", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "16107333", "url": "https://glygen.org/publication/PubMed/16107333" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Conformational changes mediate interleukin-10 receptor 2 (IL-10R2) binding to IL-10 and assembly of the signaling complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yoon SI, Logsdon NJ, Sheikh F, Donnelly RP, Walter MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "16982608", "url": "https://glygen.org/publication/PubMed/16982608" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "Structure and neutrophil-activating properties of a novel inflammatory peptide (ENA-78) with homology to interleukin 8.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "Walz A, Burgener R, Car B, Baggiolini M, Kunkel SL, Strieter RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "1744577", "url": "https://glygen.org/publication/PubMed/1744577" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Structure and functional expression of a human interleukin-8 receptor.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Holmes WE, Lee J, Kuang WJ, Rice GC, Wood WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "1840701", "url": "https://glygen.org/publication/PubMed/1840701" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Cloning of complementary DNA encoding a functional human interleukin-8 receptor.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Murphy PM, Tiffany HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "1891716", "url": "https://glygen.org/publication/PubMed/1891716" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "IL-10 inhibits cytokine production by activated macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1991", "authors": "Fiorentino DF, Zlotnik A, Mosmann TR, Howard M, O'Garra A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940369", "url": "https://glygen.org/publication/PubMed/1940369" } ] }, { "title": "Interleukin 10(IL-10) inhibits cytokine synthesis by human monocytes: an autoregulatory role of IL-10 produced by monocytes.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "de Waal Malefyt R, Abrams J, Bennett B, Figdor CG, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940799", "url": "https://glygen.org/publication/PubMed/1940799" } ] }, { "title": "CCL19 is a specific ligand of the constitutively recycling atypical human chemokine receptor CRAM-B.", "journal": "Immunology", "date": "2010", "authors": "Leick M, Catusse J, Follo M, Nibbs RJ, Hartmann TN, Veelken H, Burger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "20002784", "url": "https://glygen.org/publication/PubMed/20002784" } ] }, { "title": "Cyclooxygenase-2 is a novel transcriptional target of the nuclear EGFR-STAT3 and EGFRvIII-STAT3 signaling axes.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Lo HW, Cao X, Zhu H, Ali-Osman F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "20145033", "url": "https://glygen.org/publication/PubMed/20145033" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Cloning and sequencing of a new gro transcript from activated human monocytes: expression in leukocytes and wound tissue.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Iida N, Grotendorst GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "2078213", "url": "https://glygen.org/publication/PubMed/2078213" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Identification of three related human GRO genes encoding cytokine functions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Haskill S, Peace A, Morris J, Sporn SA, Anisowicz A, Lee SW, Smith T, Martin G, Ralph P, Sager R", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "2217207", "url": "https://glygen.org/publication/PubMed/2217207" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Characterization of human platelet basic protein, a precursor form of low-affinity platelet factor 4 and beta-thromboglobulin.", "journal": "Biochemistry", "date": "1986", "authors": "Holt JC, Harris ME, Holt AM, Lange E, Henschen A, Niewiarowski S", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "2423119", "url": "https://glygen.org/publication/PubMed/2423119" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin.", "journal": "The EMBO journal", "date": "1988", "authors": "Richmond A, Balentien E, Thomas HG, Flaggs G, Barton DE, Spiess J, Bordoni R, Francke U, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "2970963", "url": "https://glygen.org/publication/PubMed/2970963" } ] }, { "title": "Cloning and characterization of platelet factor 4 cDNA derived from a human erythroleukemic cell line.", "journal": "Blood", "date": "1987", "authors": "Poncz M, Surrey S, LaRocco P, Weiss MJ, Rappaport EF, Conway TM, Schwartz E", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "3098319", "url": "https://glygen.org/publication/PubMed/3098319" } ] }, { "title": "Molecular cloning of a human monocyte-derived neutrophil chemotactic factor (MDNCF) and the induction of MDNCF mRNA by interleukin 1 and tumor necrosis factor.", "journal": "The Journal of experimental medicine", "date": "1988", "authors": "Matsushima K, Morishita K, Yoshimura T, Lavu S, Kobayashi Y, Lew W, Appella E, Kung HF, Leonard EJ, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "3260265", "url": "https://glygen.org/publication/PubMed/3260265" } ] }, { "title": "Toxoplasma gondii GRA28 Is Required for Placenta-Specific Induction of the Regulatory Chemokine CCL22 in Human and Mouse.", "journal": "mBio", "date": "2021", "authors": "Rudzki EN, Ander SE, Coombs RS, Alrubaye HS, Cabo LF, Blank ML, Gutierrez-Melo N, Dubey JP, Coyne CB, Boyle JP", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "34781732", "url": "https://glygen.org/publication/PubMed/34781732" } ] }, { "title": "Tumor-associated macrophage (TAM)-derived CCL22 induces FAK addiction in esophageal squamous cell carcinoma (ESCC).", "journal": "Cellular & molecular immunology", "date": "2022", "authors": "Chen J, Zhao D, Zhang L, Zhang J, Xiao Y, Wu Q, Wang Y, Zhan Q", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "35962191", "url": "https://glygen.org/publication/PubMed/35962191" } ] }, { "title": "Spatial Transcriptomics Analysis Reveals that CCL17 and CCL22 are Robust Indicators of a Suppressive Immune Environment in Angioimmunoblastic T Cell Lymphoma (AITL).", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2022-09-29", "authors": "Du Jun, Qiu Chen, Li Wei-Song, Wang Bing, Han Xin-Le, Lin Su-Wen, Fu Xue-Hang, Hou Jian, Huang Zou-Fang", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "36224014", "url": "https://glygen.org/publication/PubMed/36224014" } ] }, { "title": "CCL17 and CCL22 chemokines are upregulated in human obesity and play a role in vascular dysfunction.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Hueso Luisa, Marques Patrice, Morant Brenda, Gonzalez-Navarro Herminia, Ortega Joaquin, Real Jos\u00e9 T, Sanz Mar\u00eda J, Piqueras Laura", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "37124725", "url": "https://glygen.org/publication/PubMed/37124725" } ] }, { "title": "Macrophage-Derived Chemokine MDC/CCL22: An Ambiguous Finding in COVID-19.", "journal": "International journal of molecular sciences", "date": "2023-08-23", "authors": "Korobova Zoia R, Arsentieva Natalia A, Totolian Areg A", "evidence": [ { "database": "RefSeq", "id": "NP_002981", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002981" } ], "reference": [ { "type": "PubMed", "id": "37685890", "url": "https://glygen.org/publication/PubMed/37685890" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interleukin-10 inhibits B7 and intercellular adhesion molecule-1 expression on human monocytes.", "journal": "European journal of immunology", "date": "1994", "authors": "Willems F, Marchant A, Delville JP, Gerard C, Delvaux A, Velu T, de Boer M, Goldman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512027", "url": "https://glygen.org/publication/PubMed/7512027" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Interleukin 12 synergizes with B7/CD28 interaction in inducing efficient proliferation and cytokine production of human T cells.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kubin M, Kamoun M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7516408", "url": "https://glygen.org/publication/PubMed/7516408" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "IL-10 induces the tyrosine phosphorylation of tyk2 and Jak1 and the differential assembly of STAT1 alpha and STAT3 complexes in human T cells and monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Finbloom DS, Winestock KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7543512", "url": "https://glygen.org/publication/PubMed/7543512" } ] }, { "title": "IL-10 inhibits metalloproteinase and stimulates TIMP-1 production in human mononuclear phagocytes.", "journal": "The Journal of clinical investigation", "date": "1995", "authors": "Lacraz S, Nicod LP, Chicheportiche R, Welgus HG, Dayer JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7593617", "url": "https://glygen.org/publication/PubMed/7593617" } ] }, { "title": "Inhibition of macrophage inflammatory protein-1 alpha expression by IL-10. Differential sensitivities in human blood monocytes and alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Berkman N, John M, Roesems G, Jose PJ, Barnes PJ, Chung KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7594602", "url": "https://glygen.org/publication/PubMed/7594602" } ] }, { "title": "Molecular cloning and functional characterization of human lymphotactin.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Kennedy J, Kelner GS, Kleyensteuber S, Schall TJ, Weiss MC, Yssel H, Schneider PV, Cocks BG, Bacon KB, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7602097", "url": "https://glygen.org/publication/PubMed/7602097" } ] }, { "title": "Cloning and functional expression of a human eosinophil CC chemokine receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Combadiere C, Ahuja SK, Murphy PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7622448", "url": "https://glygen.org/publication/PubMed/7622448" } ] }, { "title": "Molecular cloning and functional expression of a novel CC chemokine receptor cDNA from a human basophilic cell line.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Power CA, Meyer A, Nemeth K, Bacon KB, Hoogewerf AJ, Proudfoot AE, Wells TN", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7642634", "url": "https://glygen.org/publication/PubMed/7642634" } ] }, { "title": "Molecular cloning, functional expression, and signaling characteristics of a C-C chemokine receptor.", "journal": "Cell", "date": "1993", "authors": "Neote K, DiGregorio D, Mak JY, Horuk R, Schall TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7679328", "url": "https://glygen.org/publication/PubMed/7679328" } ] }, { "title": "Direct effects of IL-10 on subsets of human CD4+ T cell clones and resting T cells. Specific inhibition of IL-2 production and proliferation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Yssel H, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7684412", "url": "https://glygen.org/publication/PubMed/7684412" } ] }, { "title": "IL-10 inhibits macrophage costimulatory activity by selectively inhibiting the up-regulation of B7 expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Ding L, Linsley PS, Huang LY, Germain RN, Shevach EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7687627", "url": "https://glygen.org/publication/PubMed/7687627" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Cloning of human and mouse EBI1, a lymphoid-specific G-protein-coupled receptor encoded on human chromosome 17q12-q21.2.", "journal": "Genomics", "date": "1994", "authors": "Schweickart VL, Raport CJ, Godiska R, Byers MG, Eddy RL Jr, Shows TB, Gray PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7851893", "url": "https://glygen.org/publication/PubMed/7851893" } ] }, { "title": "Molecular cloning of a novel C or gamma type chemokine, SCM-1.", "journal": "FEBS letters", "date": "1995", "authors": "Yoshida T, Imai T, Kakizaki M, Nishimura M, Yoshie O", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "7875320", "url": "https://glygen.org/publication/PubMed/7875320" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Figdor CG, Huijbens R, Mohan-Peterson S, Bennett B, Culpepper J, Dang W, Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7902377", "url": "https://glygen.org/publication/PubMed/7902377" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "cDNA cloning and functional expression of a human monocyte chemoattractant protein 1 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Yamagami S, Tokuda Y, Ishii K, Tanaka H, Endo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "8048929", "url": "https://glygen.org/publication/PubMed/8048929" } ] }, { "title": "Interleukin 10 suppression of monocyte prostaglandin H synthase-2. Mechanism of inhibition of prostaglandin-dependent matrix metalloproteinase production.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Mertz PM, DeWitt DL, Stetler-Stevenson WG, Wahl LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8063757", "url": "https://glygen.org/publication/PubMed/8063757" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Interleukin 10 (IL-10) inhibits human lymphocyte interferon gamma-production by suppressing natural killer cell stimulatory factor/IL-12 synthesis in accessory cells.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "D'Andrea A, Aste-Amezaga M, Valiante NM, Ma X, Kubin M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8102388", "url": "https://glygen.org/publication/PubMed/8102388" } ] }, { "title": "Expression cloning and characterization of a human IL-10 receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Liu Y, Wei SH, Ho AS, de Waal Malefyt R, Moore KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8120391", "url": "https://glygen.org/publication/PubMed/8120391" } ] }, { "title": "Interleukin 10 (IL-10) upregulates IL-1 receptor antagonist production from lipopolysaccharide-stimulated human polymorphonuclear leukocytes by delaying mRNA degradation.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Cassatella MA, Meda L, Gasperini S, Calzetti F, Bonora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8163946", "url": "https://glygen.org/publication/PubMed/8163946" } ] }, { "title": "The effects of interleukin-10 on interleukin-1 receptor antagonist and interleukin-1 beta production in human monocytes and neutrophils.", "journal": "Lymphokine and cytokine research", "date": "1994", "authors": "Jenkins JK, Malyak M, Arend WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8186324", "url": "https://glygen.org/publication/PubMed/8186324" } ] }, { "title": "Macrophage-colony-stimulating factor expression by anti-CD45 stimulated human monocytes is transcriptionally up-regulated by IL-1 beta and inhibited by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Gruber MF, Williams CC, Gerrard TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8301137", "url": "https://glygen.org/publication/PubMed/8301137" } ] }, { "title": "Epstein-Barr virus-induced genes: first lymphocyte-specific G protein-coupled peptide receptors.", "journal": "Journal of virology", "date": "1993", "authors": "Birkenbach M, Josefsen K, Yalamanchili R, Lenoir G, Kieff E", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "8383238", "url": "https://glygen.org/publication/PubMed/8383238" } ] }, { "title": "Elevated plasma levels of tumor necrosis factor (TNF)-alpha, soluble TNF receptors, interleukin (IL)-6, and IL-10 in patients with hemorrhagic fever with renal syndrome.", "journal": "The Journal of infectious diseases", "date": "1996", "authors": "Linderholm M, Ahlm C, Settergren B, Waage A, Tarnvik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8537680", "url": "https://glygen.org/publication/PubMed/8537680" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Molecular cloning and functional expression of a new human CC-chemokine receptor gene.", "journal": "Biochemistry", "date": "1996", "authors": "Samson M, Labbe O, Mollereau C, Vassart G, Parmentier M", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "8639485", "url": "https://glygen.org/publication/PubMed/8639485" } ] }, { "title": "Receptors for interleukin (IL)-10 and IL-6-type cytokines use similar signaling mechanisms for inducing transcription through IL-6 response elements.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lai CF, Ripperger J, Morella KK, Jurlander J, Hawley TS, Carson WE, Kordula T, Caligiuri MA, Hawley RG, Fey GH, Baumann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8662928", "url": "https://glygen.org/publication/PubMed/8662928" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Interleukin-10 drives human monocytes to CD16 positive macrophages.", "journal": "Journal of inflammation", "date": "1996", "authors": "Calzada-Wack JC, Frankenberger M, Ziegler-Heitbrock HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8734788", "url": "https://glygen.org/publication/PubMed/8734788" } ] }, { "title": "IL-4, IL-10 and IFN-gamma have distinct, but interacting, effects on differentiation-induced changes in TNF-alpha and TNF receptor release by cultured human monocytes.", "journal": "Cytokine", "date": "1996", "authors": "Joyce DA, Steer JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8742066", "url": "https://glygen.org/publication/PubMed/8742066" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Structure and expression of two highly related genes encoding SCM-1/human lymphotactin.", "journal": "FEBS letters", "date": "1996", "authors": "Yoshida T, Imai T, Takagi S, Nishimura M, Ishikawa I, Yaoi T, Yoshie O", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "8849694", "url": "https://glygen.org/publication/PubMed/8849694" } ] }, { "title": "Regulation of surface and soluble TNF receptor expression on human monocytes and synovial fluid macrophages by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Hart PH, Hunt EK, Bonder CS, Watson CJ, Finlay-Jones JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8871669", "url": "https://glygen.org/publication/PubMed/8871669" } ] }, { "title": "Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.", "journal": "Protein science : a publication of the Protein Society", "date": "1996", "authors": "Zdanov A, Schalk-Hihi C, Wlodawer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8897595", "url": "https://glygen.org/publication/PubMed/8897595" } ] }, { "title": "Stat3 recruitment by two distinct ligand-induced, tyrosine-phosphorylated docking sites in the interleukin-10 receptor intracellular domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Weber-Nordt RM, Riley JK, Greenlund AC, Moore KW, Darnell JE, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8910398", "url": "https://glygen.org/publication/PubMed/8910398" } ] }, { "title": "Contrasting effects of IL-4, IL-10 and corticosteroids on RANTES production by human monocytes.", "journal": "International immunology", "date": "1996", "authors": "Marfaing-Koka A, Maravic M, Humbert M, Galanaud P, Emilie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8921438", "url": "https://glygen.org/publication/PubMed/8921438" } ] }, { "title": "IL-10 suppresses cell surface CD23/Fc epsilon RII expression, not by enhancing soluble CD23 release, but by reducing CD23 mRNA expression in human monocytes.", "journal": "Journal of clinical immunology", "date": "1996", "authors": "Morinobu A, Kumagai S, Yanagida H, Ota H, Ishida H, Matsui M, Yodoi J, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8946277", "url": "https://glygen.org/publication/PubMed/8946277" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Rossi DL, Vicari AP, Franz-Bacon K, McClanahan TK, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9013939", "url": "https://glygen.org/publication/PubMed/9013939" } ] }, { "title": "A new class of membrane-bound chemokine with a CX3C motif.", "journal": "Nature", "date": "1997", "authors": "Bazan JF, Bacon KB, Hardiman G, Wang W, Soo K, Rossi D, Greaves DR, Zlotnik A, Schall TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9024663", "url": "https://glygen.org/publication/PubMed/9024663" } ] }, { "title": "Human macrophage-derived chemokine (MDC), a novel chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells.", "journal": "J. Exp. Med.", "date": "1997", "authors": "Godiska R, Chantry D, Raport CJ, Sozzani S, Allavena P, Leviten D, Mantovani A, Gray PW", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "reference": [ { "type": "PubMed", "id": "9151897", "url": "https://glygen.org/publication/PubMed/9151897" } ] }, { "title": "Cloning and characterization of the human granulocyte chemotactic protein-2 gene.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Rovai LE, Herschman HR, Smith JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9164944", "url": "https://glygen.org/publication/PubMed/9164944" } ] }, { "title": "STRL33, A novel chemokine receptor-like protein, functions as a fusion cofactor for both macrophage-tropic and T cell line-tropic HIV-1.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Liao F, Alkhatib G, Peden KW, Sharma G, Berger EA, Farber JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9166430", "url": "https://glygen.org/publication/PubMed/9166430" } ] }, { "title": "Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Baba M, Imai T, Nishimura M, Kakizaki M, Takagi S, Hieshima K, Nomiyama H, Yoshie O", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9169459", "url": "https://glygen.org/publication/PubMed/9169459" } ] }, { "title": "Identification of CCR8: a human monocyte and thymus receptor for the CC chemokine I-309.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Tiffany HL, Lautens LL, Gao JL, Pease J, Locati M, Combadiere C, Modi W, Bonner TI, Murphy PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9207005", "url": "https://glygen.org/publication/PubMed/9207005" } ] }, { "title": "High expression of the chemokine receptor CCR3 in human blood basophils. Role in activation by eotaxin, MCP-4, and other chemokines.", "journal": "The Journal of clinical investigation", "date": "1997", "authors": "Uguccioni M, Mackay CR, Ochensberger B, Loetscher P, Rhis S, LaRosa GJ, Rao P, Ponath PD, Baggiolini M, Dahinden CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9276730", "url": "https://glygen.org/publication/PubMed/9276730" } ] }, { "title": "Identification and functional characterization of a second chain of the interleukin-10 receptor complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Kotenko SV, Krause CD, Izotova LS, Pollack BP, Wu W, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9312047", "url": "https://glygen.org/publication/PubMed/9312047" } ] }, { "title": "Molecular cloning and functional characterization of a novel CC chemokine, stimulated T cell chemotactic protein (STCP-1) that specifically acts on activated T lymphocytes.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Chang Ms, McNinch J, Elias C 3rd, Manthey CL, Grosshans D, Meng T, Boone T, Andrew DP", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "reference": [ { "type": "PubMed", "id": "9312138", "url": "https://glygen.org/publication/PubMed/9312138" } ] }, { "title": "Interleukin-10 upregulates tumor necrosis factor receptor type-II (p75) gene expression in endotoxin-stimulated human monocytes.", "journal": "Blood", "date": "1997", "authors": "Dickensheets HL, Freeman SL, Smith MF, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9354687", "url": "https://glygen.org/publication/PubMed/9354687" } ] }, { "title": "Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion.", "journal": "Cell", "date": "1997", "authors": "Imai T, Hieshima K, Haskell C, Baba M, Nagira M, Nishimura M, Kakizaki M, Takagi S, Nomiyama H, Schall TJ, Yoshie O", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9390561", "url": "https://glygen.org/publication/PubMed/9390561" } ] }, { "title": "Macrophage-derived chemokine is a functional ligand for the CC chemokine receptor 4.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Imai T, Chantry D, Raport CJ, Wood CL, Nishimura M, Godiska R, Yoshie O, Gray PW", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "reference": [ { "type": "PubMed", "id": "9430724", "url": "https://glygen.org/publication/PubMed/9430724" } ] }, { "title": "Interleukin 10 increases CCR5 expression and HIV infection in human monocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Sozzani S, Ghezzi S, Iannolo G, Luini W, Borsatti A, Polentarutti N, Sica A, Locati M, Mackay C, Wells TN, Biswas P, Vicenzi E, Poli G, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9449724", "url": "https://glygen.org/publication/PubMed/9449724" } ] }, { "title": "B cell-attracting chemokine 1, a human CXC chemokine expressed in lymphoid tissues, selectively attracts B lymphocytes via BLR1/CXCR5.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Legler DF, Loetscher M, Roos RS, Clark-Lewis I, Baggiolini M, Moser B", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9463416", "url": "https://glygen.org/publication/PubMed/9463416" } ] }, { "title": "IFN-gamma and IL-10 inhibit induction of IL-1 receptor type I and type II gene expression by IL-4 and IL-13 in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Dickensheets HL, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9550426", "url": "https://glygen.org/publication/PubMed/9550426" } ] }, { "title": "Crystal structure of chemically synthesized [N33A] stromal cell-derived factor 1alpha, a potent ligand for the HIV-1 `fusin` coreceptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Dealwis C, Fernandez EJ, Thompson DA, Simon RJ, Siani MA, Lolis E", "evidence": [ { "database": "Reactome", "id": "R-HSA-380108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108" } ], "reference": [ { "type": "PubMed", "id": "9618518", "url": "https://glygen.org/publication/PubMed/9618518" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "STCP-1 (MDC) CC chemokine acts specifically on chronically activated Th2 lymphocytes and is produced by monocytes on stimulation with Th2 cytokines IL-4 and IL-13.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Andrew DP, Chang MS, McNinch J, Wathen ST, Rihanek M, Tseng J, Spellberg JP, Elias CG 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9794440", "url": "https://glygen.org/publication/PubMed/9794440" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Structural and biological stability of the human interleukin 10 homodimer.", "journal": "Biochemistry", "date": "1998", "authors": "Syto R, Murgolo NJ, Braswell EH, Mui P, Huang E, Windsor WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9836587", "url": "https://glygen.org/publication/PubMed/9836587" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Interleukin 10 (IL-10) inhibition of primary human prostate cell-induced angiogenesis: IL-10 stimulation of tissue inhibitor of metalloproteinase-1 and inhibition of matrix metalloproteinase (MMP)-2/MMP-9 secretion.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1999", "authors": "Stearns ME, Rhim J, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9918218", "url": "https://glygen.org/publication/PubMed/9918218" } ] } ], "pathway": [ { "id": "hsa:6367", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6367", "resource": "KEGG Pathway" }, { "id": "R-HSA-380108", "name": "Chemokine receptors bind chemokines", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-380108", "resource": "Reactome", "description": "Chemokine receptors bind chemokines" }, { "id": "R-HSA-6783783", "name": "Interleukin-10 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "resource": "Reactome", "description": "Interleukin-10 signaling" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "O88430-1", "protein_name": "C-C motif chemokine 22", "gene_name": "Ccl22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATLRVPLLVALVLLAVAIQTSDAGPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS", "length": 92 }, "evidence": [ { "id": "45240727", "url": "http://www.informatics.jax.org/homology/45240727", "database": "MGI" }, { "id": "O00626", "url": "https://omabrowser.org/oma/group/O00626/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 19, "go_terms": [ { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "chemokine-mediated signaling pathway", "id": "GO:0070098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070098", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "lymphocyte chemotaxis", "id": "GO:0048247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048247", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "killing of cells of another organism", "id": "GO:0031640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031640", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "monocyte chemotaxis", "id": "GO:0002548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002548", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "cellular response to interleukin-1", "id": "GO:0071347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071347", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "neutrophil chemotaxis", "id": "GO:0030593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "eosinophil chemotaxis", "id": "GO:0048245", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048245", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "chemokine activity", "id": "GO:0008009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008009", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" }, { "name": "CCR chemokine receptor binding", "id": "GO:0048020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048020", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "The N-terminal processed forms MDC(3-69), MDC(5-69) and MDC(7-69) are produced by proteolytic cleavage after secretion from monocyte derived dendrocytes.", "evidence": [ { "database": "UniProtKB", "id": "O00626", "url": "https://www.uniprot.org/uniprot/O00626" }, { "database": "PubMed", "id": "11241286", "url": "https://glygen.org/publication/PubMed/11241286" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 182 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }