{ "uniprot_canonical_ac": "M9PJN5-1", "uniprot_ac": "M9PJN5", "uniprot_id": "M9PJN5_DROME", "mass": { "chemical_mass": 130897.0, "monoisotopic_mass": 130897.0 }, "refseq": { "ac": "NP_573017", "name": "histone deacetylase 6, isoform A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573017" }, "gene_names": [ { "name": "HDAC6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "CG6170; dHDAC2; DHDAC2; dHDAC6; Dmel\\CG6170; dmHDA404; DmHDAC2; HDAC; HDAC2; hdac6; hDAC6; Hdac6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259569", "id": "NP_001259569" }, { "name": "CG6170", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "DHDAC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "DmHDAC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "Dmel\\CG6170", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "Dmel_CG6170", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "HDAC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "HDAC6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259569", "id": "NP_001259569" }, { "name": "HDAC", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "dHDAC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "dHDAC6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "dmHDA404", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" }, { "name": "hdac6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/M9PJN5", "id": "M9PJN5" } ], "protein_names": [ { "name": "3.5.1.98", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "M9PJN5" }, { "name": "CG6170-PA; HDAC6-PA; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573017", "id": "NP_573017" }, { "name": "CG6170-PB; HDAC6-PB; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_727842", "id": "NP_727842" }, { "name": "CG6170-PC; HDAC6-PC; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_727843", "id": "NP_727843" }, { "name": "CG6170-PD; HDAC6-PD; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162760", "id": "NP_001162760" }, { "name": "CG6170-PE; HDAC6-PE; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245680", "id": "NP_001245680" }, { "name": "CG6170-PF; HDAC6-PF; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245681", "id": "NP_001245681" }, { "name": "CG6170-PG; HDAC6-PG; histone deacetylase 6; histone deacetylase HDA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259569", "id": "NP_001259569" }, { "name": "Histone deacetylase 6, isoform G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "M9PJN5" }, { "name": "histone deacetylase 6, isoform A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_573017", "id": "NP_573017" }, { "name": "histone deacetylase 6, isoform B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_727842", "id": "NP_727842" }, { "name": "histone deacetylase 6, isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_727843", "id": "NP_727843" }, { "name": "histone deacetylase 6, isoform D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162760", "id": "NP_001162760" }, { "name": "histone deacetylase 6, isoform E", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245680", "id": "NP_001245680" }, { "name": "histone deacetylase 6, isoform F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001245681", "id": "NP_001245681" }, { "name": "histone deacetylase 6, isoform G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259569", "id": "NP_001259569" } ], "function": [], "disease": [ { "disease_id": "DOID:0050770", "recommended_name": { "id": "DOID:0050770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050770", "name": "polycystic liver disease", "description": "A liver disease that is characterized by the presence of multiple cysts located_in the liver." }, "synonyms": [ { "id": "DOID:0050770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050770", "name": "congenital cystic liver disease", "description": "" }, { "id": "DOID:0050770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050770", "name": "congenital hepatic cyst", "description": "" }, { "id": "DOID:0050770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050770", "name": "fibrocystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "polycystic liver disease 1", "description": "A polycystic liver disease in which the cause of the disease is a mutation in the PRKCSH gene, and is characterized by the appearance of numerous cysts spread throughout the liver." }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "isolated congenital polycystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "isolated polycystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "PCLD1", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "nonsyndromic congenital polycystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "nonsyndromic polycystic liver disease (disease)", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "polycystic liver disease 1", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "polycystic liver disease 1 with or without kidney cysts", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "ADPCLD", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "PCLD", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "autosomal dominant polycystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "isolated autosomal dominant polycystic liver disease", "description": "" }, { "id": "MONDO:0008265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008265", "name": "polycystic liver disease", "description": "" }, { "id": "MIM:174050", "resource": "MIM", "url": "https://www.omim.org/entry/174050", "name": "Polycystic liver disease 1 with or without kidney cysts", "description": "Polycystic liver disease 1 with or without kidney cysts" } ], "evidence": [ { "id": "0050770", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050770" } ] }, { "disease_id": "DOID:0112106", "recommended_name": { "id": "DOID:0112106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112106", "name": "chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia", "description": "A syndrome characterized by chondrodysplasia associated with other features including intrauterine growth retardation, hydrocephaly, macrocephaly, frontal bossing, microphthalmia, small low-set ears, and short flat nose that has_material_basis_in heterozygous mutation in the HDAC6 gene on chromosome Xp11.23." }, "synonyms": [ { "id": "DOID:0112106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112106", "name": "X-linked dominant chondrodysplasia, Chassaing-Lacombe type", "description": "" }, { "id": "DOID:0112106", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112106", "name": "X-linked dominant chondrodysplasia-hydrocephaly-microphthalmia syndrome", "description": "" }, { "id": "MONDO:0010463", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010463", "name": "X-linked dominant chondrodysplasia, Chassaing-Lacombe type", "description": "A rare genetic bone disorder characterized by chondrodysplasia, intrauterine growth retardation (IUGR), hydrocephaly and facial dysmorphism in the affected males." }, { "id": "MONDO:0010463", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010463", "name": "X-linked dominant chondrodysplasia-hydrocephaly-microphthalmia syndrome", "description": "" }, { "id": "MONDO:0010463", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010463", "name": "chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia, X-linked dominant", "description": "" }, { "id": "MONDO:0010463", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010463", "name": "chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia", "description": "" }, { "id": "MIM:300863", "resource": "MIM", "url": "https://www.omim.org/entry/300863", "name": "Chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia", "description": "Chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia" } ], "evidence": [ { "id": "0112106", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0112106" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:4947", "recommended_name": { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "cholangiocarcinoma", "description": "A bile duct adenocarcinoma that has_material_basis_in bile duct epithelial cells." }, "synonyms": [ { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "adult primary Cholangiocarcinoma", "description": "" }, { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "adult primary cholangiocellular carcinoma", "description": "" }, { "id": "DOID:4947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4947", "name": "cholangiosarcoma", "description": "" } ], "evidence": [ { "id": "4947", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4947" } ] }, { "disease_id": "DOID:8991", "recommended_name": { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "cervix uteri carcinoma in situ", "description": "An uterus carcinoma in situ that is located_in the uterine cervix." }, "synonyms": [ { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "CIN III", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "CIN III - carcinoma in situ of cervix", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "CIN III - severe dyskaryosis", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "Cervix Ca in situ", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "Severe Dysplasia of the Cervix Uteri", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "Severe dysplasia of cervix", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "cervical intraepithelial neoplasia grade III with severe dysplasia", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "carcinoma in situ of cervix", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "carcinoma in situ of uterine cervix", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "carcinoma of cervix stage 0", "description": "" }, { "id": "DOID:8991", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8991", "name": "squamous intraepithelial neoplasia, grade III", "description": "" } ], "evidence": [ { "id": "8991", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8991" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "HDAC6", "url": "https://www.uniprot.org/uniprot/M9PJN5", "locus": { "chromosome": "X", "start_pos": 15340360, "end_pos": 15333310, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0026428", "url": "https://www.ensembl.org/id/FBgn0026428" } ] } } ], "crossref": [ { "id": "FBgn0026428", "url": "https://bgee.org/?page=gene&gene_id=FBgn0026428", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd10002", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10002", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10003", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10003", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0026428", "url": "https://flybase.org/reports/FBgn0026428", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "32461", "url": "https://www.ncbi.nlm.nih.gov/gene/32461", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q86NK9", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q86NK9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q8IR38", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8IR38*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000286", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000286", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001607", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001607", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023696", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023696", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023801", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023801", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG6170", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6170", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MCHLEEL", "url": "https://omabrowser.org/oma/group/MCHLEEL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "124800at2759", "url": "http://www.orthodb.org/?query=124800at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45364", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45364", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45364:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45364:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00850", "url": "http://pfam.xfam.org/family/PF00850", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02148", "url": "http://pfam.xfam.org/family/PF02148", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-3371511", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-3371511", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-350054", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-350054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-9646399", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9646399", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001259569", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001259569", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "58196", "url": "https://www.rhea-db.org/rhea/58196", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M9NEH6-1", "url": "https://www.uniprot.org/uniprot/M9NEH6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M9NGF7-1", "url": "https://www.uniprot.org/uniprot/M9NGF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M9PJN5-1", "url": "https://www.uniprot.org/uniprot/M9PJN5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86NK9-1", "url": "https://www.uniprot.org/uniprot/Q86NK9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IR37-1", "url": "https://www.uniprot.org/uniprot/Q8IR37-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IR38-1", "url": "https://www.uniprot.org/uniprot/Q8IR38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9XYX1-1", "url": "https://www.uniprot.org/uniprot/Q9XYX1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNNXPLAIRVLDALTDYLCALCPPLRHLIHFLAEHLWPLLERIYLNLLHYFLAH", "length": 1179, "header": "tr|M9PJN5-1|M9PJN5_DROME Isoform 1 of Histone deacetylase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "isoforms": [ { "isoform_ac": "M9NEH6-1", "url": "", "sequence": { "sequence": "MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRCKPMQSGEDSLPFWSR", "length": 1022, "header": "tr|M9NEH6-1|M9NEH6_DROME Computationally mapped isoform of Histone deacetylase 6, isoform F OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15338971, "end_pos": 15334651, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0307384", "url": "https://www.ensembl.org/id/FBtr0307384" }, { "database": "Ensembl Peptide", "id": "FBpp0298373", "url": "https://www.ensembl.org/id/FBpp0298373" } ] } }, { "isoform_ac": "M9NGF7-1", "url": "", "sequence": { "sequence": "MASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN", "length": 1108, "header": "tr|M9NGF7-1|M9NGF7_DROME Computationally mapped isoform of Histone deacetylase 6, isoform E OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15340012, "end_pos": 15335047, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0307383", "url": "https://www.ensembl.org/id/FBtr0307383" }, { "database": "Ensembl Peptide", "id": "FBpp0298372", "url": "https://www.ensembl.org/id/FBpp0298372" } ] } }, { "isoform_ac": "M9PJN5-1", "url": "", "sequence": { "sequence": "MSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNNXPLAIRVLDALTDYLCALCPPLRHLIHFLAEHLWPLLERIYLNLLHYFLAH", "length": 1179, "header": "tr|M9PJN5-1|M9PJN5_DROME Isoform 1 of Histone deacetylase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15340165, "end_pos": 15334061, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0330405", "url": "https://www.ensembl.org/id/FBtr0330405" }, { "database": "Ensembl Peptide", "id": "FBpp0303431", "url": "https://www.ensembl.org/id/FBpp0303431" } ] } }, { "isoform_ac": "Q86NK9-1", "url": "", "sequence": { "sequence": "MSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN", "length": 1128, "header": "tr|Q86NK9-1|Q86NK9_DROME Computationally mapped isoform of Histone deacetylase 6, isoform A OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15340012, "end_pos": 15334061, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0074008", "url": "https://www.ensembl.org/id/FBtr0074008" }, { "database": "Ensembl Peptide", "id": "FBpp0073825", "url": "https://www.ensembl.org/id/FBpp0073825" } ] } }, { "isoform_ac": "Q8IR37-1", "url": "", "sequence": { "sequence": "MLTKDLNSFSQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN", "length": 1138, "header": "tr|Q8IR37-1|Q8IR37_DROME Computationally mapped isoform of Histone deacetylase 6, isoform C OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15340012, "end_pos": 15334957, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0074009", "url": "https://www.ensembl.org/id/FBtr0074009" }, { "database": "Ensembl Peptide", "id": "FBpp0073826", "url": "https://www.ensembl.org/id/FBpp0073826" } ] } }, { "isoform_ac": "Q8IR38-1", "url": "", "sequence": { "sequence": "MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRARNNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNAHMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDDNGAGSSICLRLERNN", "length": 1135, "header": "tr|Q8IR38-1|Q8IR38_DROME Computationally mapped isoform of Histone deacetylase 6, isoform B OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15340012, "end_pos": 15334651, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0074010", "url": "https://www.ensembl.org/id/FBtr0074010" }, { "database": "Ensembl Peptide", "id": "FBpp0073827", "url": "https://www.ensembl.org/id/FBpp0073827" } ] } }, { "isoform_ac": "Q9XYX1-1", "url": "", "sequence": { "sequence": "MLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPSRSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRPPGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCATLAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSKPKVKH", "length": 883, "header": "tr|Q9XYX1-1|Q9XYX1_DROME Computationally mapped isoform of Histone deacetylase 6, isoform D OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1 CANONICAL=M9PJN5-1" }, "locus": { "chromosome": "X", "start_pos": 15339629, "end_pos": 15335212, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0301774", "url": "https://www.ensembl.org/id/FBtr0301774" }, { "database": "Ensembl Peptide", "id": "FBpp0290988", "url": "https://www.ensembl.org/id/FBpp0290988" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" }, { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "M9NEH6", "url": "https://www.uniprot.org/uniprot/M9NEH6" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" }, { "database": "UniProtKB", "id": "M9NGF7", "url": "https://www.uniprot.org/uniprot/M9NGF7" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "Recent strong positive selection on Drosophila melanogaster HDAC6, a gene encoding a stress surveillance factor, as revealed by population genomic analysis.", "journal": "Mol. Biol. Evol.", "date": "2009", "authors": "Pavlidis P., Stephan W., Svetec N.", "evidence": [ { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" } ], "reference": [ { "type": "PubMed", "id": "19349642", "url": "https://glygen.org/publication/PubMed/19349642" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q8IR37", "url": "https://www.uniprot.org/uniprot/Q8IR37" }, { "database": "UniProtKB", "id": "Q8IR38", "url": "https://www.uniprot.org/uniprot/Q8IR38" }, { "database": "UniProtKB", "id": "Q9XYX1", "url": "https://www.uniprot.org/uniprot/Q9XYX1" }, { "database": "UniProtKB", "id": "Q86NK9", "url": "https://www.uniprot.org/uniprot/Q86NK9" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG6170", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG6170", "resource": "KEGG Pathway" }, { "id": "R-DME-3371511", "name": "HSF1 activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-3371511", "resource": "Reactome", "description": "HSF1 activation" }, { "id": "R-DME-350054", "name": "Notch-HLH transcription pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-350054", "resource": "Reactome", "description": "Notch-HLH transcription pathway" }, { "id": "R-DME-9646399", "name": "Aggrephagy", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9646399", "resource": "Reactome", "description": "Aggrephagy" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "neurotransmitter secretion", "id": "GO:0007269", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007269", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "protein deacetylation", "id": "GO:0006476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006476", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "negative regulation of axon regeneration", "id": "GO:0048681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048681", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "presynapse", "id": "GO:0098793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "histone deacetylase complex", "id": "GO:0000118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000118", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "deacetylase activity", "id": "GO:0019213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019213", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "histone deacetylase activity", "id": "GO:0004407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004407", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" }, { "name": "NAD-independent histone deacetylase activity", "id": "GO:0045129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045129", "evidence": [ { "database": "UniProtKB", "id": "M9PJN5", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 331, "end_pos": 333, "annotation": "n_glycosylation_sequon" }, { "start_pos": 549, "end_pos": 551, "annotation": "n_glycosylation_sequon" }, { "start_pos": 706, "end_pos": 708, "annotation": "n_glycosylation_sequon" }, { "start_pos": 924, "end_pos": 926, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "58196", "name": "", "equation": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q99P96-1", "Q6P6W3-1", "Q4QQW4-1", "D3ZVU7-1", "E5RQ38-1", "B1WC68-1", "A0A8I6G4R8-1", "F7ENH8-1", "Q99P99-1", "Q9BY41-1", "O15379-1", "Q9UQL6-1", "Q8WUI4-1", "P56524-1", "Q96DB2-1", "Q92769-1", "Q9UBN7-1", "Q13547-1", "Q9UKV0-1", "Q8C2B3-1", "Q91WA3-1", "Q99N13-1", "Q9Z2V6-1", "Q8VH37-1", "Q9Z2V5-1", "O09106-1", "P70288-1", "O88895-1", "Q6NZM9-1", "P32561-1", "P53096-1", "P53973-1", "Q02959-1", "Q12214-1", "Q54VQ7-1", "Q54X15-1", "Q55FN5-1", "Q55BW2-1", "Q9VC26-1", "M9PJN5-1", "Q94517-1", "M9PHQ2-1", "Q7KTS4-1" ], "evidence": [ { "id": "58196", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58196" } ] }, { "id": "R-DME-350058", "name": "Formation of CSL NCOR corepressor complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q94517-1", "M9PJN5-1", "Q7KTS4-1", "Q9VC26-1", "M9PHQ2-1" ], "evidence": [ { "id": "R-DME-350058", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-350058" } ] }, { "id": "R-DME-5324632", "name": "Dissociation of cytosolic HSF1:HSP90:HDAC6:PTGES3 upon sensing protein aggregates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5324631" ], "output_participant_list": [ "R-DME-265269" ], "enzyme_list": [ "Q7KN62-1", "M9PJN5-1" ], "evidence": [ { "id": "R-DME-5324632", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5324632" } ] }, { "id": "R-DME-9646348", "name": "PolyUb-Misfolded Proteins:HDAC6 bind dynein motor", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9VAN4-1", "Q9W2I5-1", "Q9VC63-1", "A0A0B4KGI0-1", "M9PJN5-1", "Q9VGM1-1", "Q961D3-1" ], "evidence": [ { "id": "R-DME-9646348", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-9646348" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5324631", "participant_name": "Ub-protein aggregates [cytosol]", "crossref": [ { "id": "23367", "database": "ChEBI", "url": "" }, { "id": "23367", "database": "ChEBI", "url": "" }, { "id": "23367", "database": "ChEBI", "url": "" }, { "id": "23367", "database": "ChEBI", "url": "" }, { "id": "23367", "database": "ChEBI", "url": "" }, { "id": "23367", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-DME-265269", "participant_name": "PTGES3 [cytosol]", "crossref": [ { "id": "FBgn0037728", "database": "Flybase", "url": "" }, { "id": "NP_649925.1", "database": "RefSeq", "url": "" }, { "id": "NP_001247010.1", "database": "RefSeq", "url": "" }, { "id": "Q9VH95", "database": "PRO", "url": "" }, { "id": "Q9VH95", "database": "UniProt", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KGI0", "gene_name": "Mrp5", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "A0A0B4KGI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KGI0" } ] } ] }, { "uniprot_ac": "A0A8I6G4R8", "gene_name": "Hdac5", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "A0A8I6G4R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G4R8" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "A0A8I6G4R8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6G4R8" } ] } ] }, { "uniprot_ac": "B1WC68", "gene_name": "Hdac8", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "B1WC68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1WC68" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "B1WC68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1WC68" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "B1WC68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1WC68" } ] } ] }, { "uniprot_ac": "D3ZVU7", "gene_name": "Hdac1l", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "D3ZVU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVU7" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "D3ZVU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVU7" } ] } ] }, { "uniprot_ac": "E5RQ38", "gene_name": "Hdac9", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "E5RQ38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E5RQ38" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "E5RQ38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E5RQ38" } ] } ] }, { "uniprot_ac": "F7ENH8", "gene_name": "Hdac2", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "F7ENH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7ENH8" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "F7ENH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7ENH8" } ] } ] }, { "uniprot_ac": "M9PHQ2", "gene_name": "HDAC4", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "M9PHQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9PHQ2" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "M9PHQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9PHQ2" } ] } ] }, { "uniprot_ac": "M9PJN5", "gene_name": "HDAC6", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "M9PJN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M9PJN5" } ] } ] }, { "uniprot_ac": "O09106", "gene_name": "Hdac1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "O09106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09106" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "O09106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09106" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "O09106", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09106" } ] } ] }, { "uniprot_ac": "O15379", "gene_name": "HDAC3", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "O15379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15379" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "O15379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15379" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "O15379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15379" } ] } ] }, { "uniprot_ac": "O88895", "gene_name": "Hdac3", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "O88895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88895" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "O88895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88895" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "O88895", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88895" } ] } ] }, { "uniprot_ac": "P32561", "gene_name": "RPD3", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "P32561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32561" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "P32561", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32561" } ] } ] }, { "uniprot_ac": "P53096", "gene_name": "HOS2", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "P53096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53096" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "P53096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53096" } ] } ] }, { "uniprot_ac": "P53973", "gene_name": "HDA1", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "P53973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53973" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "P53973", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53973" } ] } ] }, { "uniprot_ac": "P56524", "gene_name": "HDAC4", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "P56524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56524" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "P56524", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56524" } ] } ] }, { "uniprot_ac": "P70288", "gene_name": "Hdac2", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "P70288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70288" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "P70288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70288" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "P70288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70288" } ] } ] }, { "uniprot_ac": "Q02959", "gene_name": "HOS3", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q02959", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02959" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q02959", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02959" } ] } ] }, { "uniprot_ac": "Q12214", "gene_name": "HOS1", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q12214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12214" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q12214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12214" } ] } ] }, { "uniprot_ac": "Q13547", "gene_name": "HDAC1", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q13547", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13547" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q13547", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13547" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q13547", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13547" } ] } ] }, { "uniprot_ac": "Q4QQW4", "gene_name": "Hdac1", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q4QQW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4QQW4" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q4QQW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4QQW4" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q4QQW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4QQW4" } ] } ] }, { "uniprot_ac": "Q54VQ7", "gene_name": "hdaC", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q54VQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VQ7" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q54VQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VQ7" } ] } ] }, { "uniprot_ac": "Q54X15", "gene_name": "hdaD", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q54X15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54X15" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q54X15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54X15" } ] } ] }, { "uniprot_ac": "Q55BW2", "gene_name": "hdaB", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q55BW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55BW2" } ] } ] }, { "uniprot_ac": "Q55FN5", "gene_name": "hdaA", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q55FN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FN5" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q55FN5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FN5" } ] } ] }, { "uniprot_ac": "Q6NZM9", "gene_name": "Hdac4", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q6NZM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NZM9" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q6NZM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NZM9" } ] } ] }, { "uniprot_ac": "Q6P6W3", "gene_name": "Hdac3", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q6P6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6W3" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q6P6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6W3" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q6P6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P6W3" } ] } ] }, { "uniprot_ac": "Q7KN62", "gene_name": "TER94", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q7KN62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN62" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "Q7KN62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KN62" } ] } ] }, { "uniprot_ac": "Q7KTS4", "gene_name": "HDAC3", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q7KTS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTS4" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q7KTS4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTS4" } ] } ] }, { "uniprot_ac": "Q8C2B3", "gene_name": "Hdac7", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q8C2B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C2B3" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q8C2B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C2B3" } ] } ] }, { "uniprot_ac": "Q8VH37", "gene_name": "Hdac8", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q8VH37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VH37" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q8VH37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VH37" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q8VH37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VH37" } ] } ] }, { "uniprot_ac": "Q8WUI4", "gene_name": "HDAC7", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q8WUI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUI4" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q8WUI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUI4" } ] } ] }, { "uniprot_ac": "Q91WA3", "gene_name": "Hdac11", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q91WA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WA3" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q91WA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WA3" } ] } ] }, { "uniprot_ac": "Q92769", "gene_name": "HDAC2", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q92769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92769" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q92769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92769" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q92769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92769" } ] } ] }, { "uniprot_ac": "Q94517", "gene_name": "HDAC1", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q94517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94517" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q94517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q94517" } ] } ] }, { "uniprot_ac": "Q961D3", "gene_name": "rdog", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "Q961D3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q961D3" } ] } ] }, { "uniprot_ac": "Q96DB2", "gene_name": "HDAC11", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q96DB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96DB2" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q96DB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96DB2" } ] } ] }, { "uniprot_ac": "Q99N13", "gene_name": "Hdac9", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q99N13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N13" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q99N13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N13" } ] } ] }, { "uniprot_ac": "Q99P96", "gene_name": "Hdac7", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q99P96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P96" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q99P96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P96" } ] } ] }, { "uniprot_ac": "Q99P99", "gene_name": "Hdac4", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q99P99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P99" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q99P99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P99" } ] } ] }, { "uniprot_ac": "Q9BY41", "gene_name": "HDAC8", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9BY41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY41" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9BY41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY41" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9BY41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY41" } ] } ] }, { "uniprot_ac": "Q9UBN7", "gene_name": "HDAC6", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9UBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBN7" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9UBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBN7" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9UBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBN7" } ] } ] }, { "uniprot_ac": "Q9UKV0", "gene_name": "HDAC9", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9UKV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKV0" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9UKV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UKV0" } ] } ] }, { "uniprot_ac": "Q9UQL6", "gene_name": "HDAC5", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9UQL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQL6" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9UQL6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQL6" } ] } ] }, { "uniprot_ac": "Q9VAN4", "gene_name": "Dmel\\CG11898", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "Q9VAN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAN4" } ] } ] }, { "uniprot_ac": "Q9VC26", "gene_name": "HDAC11", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9VC26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VC26" } ] } ] }, { "uniprot_ac": "Q9VC63", "gene_name": "Cftr", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "Q9VC63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VC63" } ] } ] }, { "uniprot_ac": "Q9VGM1", "gene_name": "Mrp4", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "Q9VGM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGM1" } ] } ] }, { "uniprot_ac": "Q9W2I5", "gene_name": "Dmel\\CG10505", "activity": [ { "ec_number": "3.6.1.3", "activity": "", "evidence": [ { "id": "Q9W2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2I5" } ] } ] }, { "uniprot_ac": "Q9Z2V5", "gene_name": "Hdac6", "activity": [ { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9Z2V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2V5" } ] }, { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9Z2V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2V5" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9Z2V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2V5" } ] } ] }, { "uniprot_ac": "Q9Z2V6", "gene_name": "Hdac5", "activity": [ { "ec_number": "3.5.1.98", "activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].", "evidence": [ { "id": "Q9Z2V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2V6" } ] }, { "ec_number": "3.5.1.98", "activity": "", "evidence": [ { "id": "Q9Z2V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2V6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }