{ "uniprot_canonical_ac": "M0RCP6-1", "uniprot_ac": "M0RCP6", "uniprot_id": "PROF3_RAT", "mass": { "chemical_mass": 14667.0, "monoisotopic_mass": 14667.0 }, "refseq": { "ac": "NP_001102957", "name": "profilin-3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102957" }, "gene_names": [ { "name": "Pfn3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/M0RCP6", "id": "M0RCP6" }, { "name": "Pfn3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102957", "id": "NP_001102957" } ], "protein_names": [ { "name": "Profilin-3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "M0RCP6" }, { "name": "Profilin III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "M0RCP6" }, { "name": "profilin III", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102957", "id": "NP_001102957" }, { "name": "profilin-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102957", "id": "NP_001102957" } ], "function": [ { "annotation": "Binds to actin and affects the structure of the cytoskeleton. Slightly reduces actin polymerization. Binds to poly-L-proline, phosphatidylinositol 3-phosphate (PtdIns(3)P), phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2), and phosphatidylinositol 4-phosphate (PtdIns(4)P). May be involved in spermatogenesis.", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Pfn3", "url": "https://www.uniprot.org/uniprot/M0RCP6", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000047752", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000047752", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00148", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00148", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "685936", "url": "https://www.ncbi.nlm.nih.gov/gene/685936", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005455", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005455", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036140", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036140", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:685936", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685936", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2965090at2759", "url": "http://www.orthodb.org/?query=2965090at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13936", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13936", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13936:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13936:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00235", "url": "http://pfam.xfam.org/family/PF00235", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_M0RCP6", "url": "http://purl.obolibrary.org/obo/PR_M0RCP6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001102957", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102957", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1587838", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1587838", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0RCP6-1", "url": "https://www.uniprot.org/uniprot/M0RCP6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGILNKTVHDLIGGLREQCS", "length": 137, "header": "sp|M0RCP6-1|PROF3_RAT Isoform 1 of Profilin-3 OS=Rattus norvegicus OX=10116 GN=Pfn3 PE=2 SV=1 CANONICAL=M0RCP6-1" }, "isoforms": [ { "isoform_ac": "M0RCP6-1", "url": "", "sequence": { "sequence": "MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGILNKTVHDLIGGLREQCS", "length": 137, "header": "sp|M0RCP6-1|PROF3_RAT Isoform 1 of Profilin-3 OS=Rattus norvegicus OX=10116 GN=Pfn3 PE=2 SV=1 CANONICAL=M0RCP6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Novel testis-expressed profilin IV associated with acrosome biogenesis and spermatid elongation.", "journal": "Mol. Hum. Reprod.", "date": "2005", "authors": "Obermann H, Raabe I, Balvers M, Brunswig B, Schulze W, Kirchhoff C", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "reference": [ { "type": "PubMed", "id": "15591451", "url": "https://glygen.org/publication/PubMed/15591451" } ] }, { "title": "Testis-expressed profilins 3 and 4 show distinct functional characteristics and localize in the acroplaxome-manchette complex in spermatids.", "journal": "BMC Cell Biol.", "date": "2009", "authors": "Behnen M, Murk K, Kursula P, Cappallo-Obermann H, Rothkegel M, Kierszenbaum AL, Kirchhoff C", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "reference": [ { "type": "PubMed", "id": "19419568", "url": "https://glygen.org/publication/PubMed/19419568" } ] } ], "pathway": [ { "id": "rno:685936", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685936", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P60673-1", "protein_name": "Profilin-3", "gene_name": "PFN3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA", "length": 137 }, "evidence": [ { "id": "45243182", "url": "http://www.informatics.jax.org/homology/45243182", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9DAD6-1", "protein_name": "Profilin-3", "gene_name": "Pfn3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGILNKTVHDLIGGLREQCS", "length": 137 }, "evidence": [ { "id": "45243182", "url": "http://www.informatics.jax.org/homology/45243182", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of actin filament bundle assembly", "id": "GO:0032233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032233", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" }, { "name": "regulation of actin filament polymerization", "id": "GO:0030833", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030833", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "M0RCP6", "url": "https://www.uniprot.org/uniprot/M0RCP6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 122, "end_pos": 124, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }