{ "uniprot_canonical_ac": "M0R8A3-1", "uniprot_ac": "M0R8A3", "uniprot_id": "M0R8A3_RAT", "mass": { "chemical_mass": 35022.0, "monoisotopic_mass": 35022.0 }, "refseq": {}, "gene_names": [ { "name": "Gp6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/M0R8A3", "id": "M0R8A3" } ], "protein_names": [ { "name": "Glycoprotein 6 (platelet)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "M0R8A3" } ], "function": [], "disease": [ { "disease_id": "DOID:0111057", "recommended_name": { "id": "DOID:0111057", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111057", "name": "platelet-type bleeding disorder 11", "description": "A blood platelet disease characterized by autosomal recessive inheritance of mild to moderate bleeding and defective platelet activation and aggregation in response to collagen that has_material_basis_in compound heterozygous mutation in the GP6 gene on chromosome 19q13." }, "synonyms": [ { "id": "DOID:0111057", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111057", "name": "BDPLT11", "description": "" }, { "id": "DOID:0111057", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111057", "name": "GP VI deficiency", "description": "" }, { "id": "DOID:0111057", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111057", "name": "glycoprotein VI deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "platelet-type bleeding disorder 11", "description": "Any inherited bleeding disorder, platelet-type in which the cause of the disease is a mutation in the GP6 gene." }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "BDPLT11", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "GP VI deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "GP6 inherited bleeding disorder, platelet-type", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "glycoprotein VI deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "inherited bleeding disorder, platelet-type caused by mutation in GP6", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "platelet-type bleeding disorder 11", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "GP 6 deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "bleeding diathesis due to glycoprotein VI deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "bleeding disorder, platelet-type, 11", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "glycoprotein 6 deficiency", "description": "" }, { "id": "MONDO:0013623", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013623", "name": "platelet-type bleeding disorder-11", "description": "" }, { "id": "MIM:614201", "resource": "MIM", "url": "https://www.omim.org/entry/614201", "name": "Bleeding disorder, platelet-type, 11", "description": "Bleeding disorder, platelet-type, 11" } ], "evidence": [ { "id": "0111057", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111057" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "common_name": "Rat" } ], "gene": [ { "name": "Gp6", "url": "https://www.uniprot.org/uniprot/M0R8A3", "locus": { "chromosome": "1", "start_pos": 69491326, "end_pos": 69465789, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000047204", "url": "https://www.ensembl.org/id/ENSRNOG00000047204" } ] } } ], "crossref": [ { "id": "ENSRNOG00000047204", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000047204", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "GPARQHY", "url": "https://omabrowser.org/oma/group/GPARQHY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11738", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11738", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11738:SF185", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11738:SF185", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-114604", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75892", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1589130", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1589130", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R8A3-1", "url": "https://www.uniprot.org/uniprot/M0R8A3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSPASLTFFCIGLCVLQVIQAQHGPLPKPSLQAQPSSLVPLGHPVTLRCLGPSDADLYRLEKVKPGKLIFIDQDFLFIPIMEINNAGRYRCSYQNESHWSLPSDQLELIATGVYSKPSLSAHPSSAIPPGRDVTLKCQSQYSFDEFVLYKEGDTRPYKRPEKWYRANFPVITVTAAHSGTYRCYSFSSSSPYLWSAPSDPLVVVVTGPSATPSQVPTEVPSPMTEASRRPSMLLTNKISTTEKPMNITVSPEGPSPPFGFAHQHYAKGNLVRICLGVMIIMFLVGFLAEDWHSRKKRLQHRIRAMQRPLPPLPLA", "length": 315, "header": "tr|M0R8A3-1|M0R8A3_RAT Isoform 1 of Glycoprotein 6 (platelet) OS=Rattus norvegicus OX=10116 GN=Gp6 PE=4 SV=1 CANONICAL=M0R8A3-1" }, "isoforms": [ { "isoform_ac": "M0R8A3-1", "url": "", "sequence": { "sequence": "MSPASLTFFCIGLCVLQVIQAQHGPLPKPSLQAQPSSLVPLGHPVTLRCLGPSDADLYRLEKVKPGKLIFIDQDFLFIPIMEINNAGRYRCSYQNESHWSLPSDQLELIATGVYSKPSLSAHPSSAIPPGRDVTLKCQSQYSFDEFVLYKEGDTRPYKRPEKWYRANFPVITVTAAHSGTYRCYSFSSSSPYLWSAPSDPLVVVVTGPSATPSQVPTEVPSPMTEASRRPSMLLTNKISTTEKPMNITVSPEGPSPPFGFAHQHYAKGNLVRICLGVMIIMFLVGFLAEDWHSRKKRLQHRIRAMQRPLPPLPLA", "length": 315, "header": "tr|M0R8A3-1|M0R8A3_RAT Isoform 1 of Glycoprotein 6 (platelet) OS=Rattus norvegicus OX=10116 GN=Gp6 PE=4 SV=1 CANONICAL=M0R8A3-1" }, "locus": { "chromosome": "1", "start_pos": 69491194, "end_pos": 69465887, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000071927.4", "url": "https://www.ensembl.org/id/ENSRNOT00000071927.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000065697.1", "url": "https://www.ensembl.org/id/ENSRNOP00000065697.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-RNO-114604", "name": "GPVI-mediated activation cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-114604", "resource": "Reactome", "description": "GPVI-mediated activation cascade" }, { "id": "R-RNO-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-RNO-75892", "name": "Platelet Adhesion to exposed collagen", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75892", "resource": "Reactome", "description": "Platelet Adhesion to exposed collagen" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "tetraspanin-enriched microdomain", "id": "GO:0097197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097197", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "peptidyl-tyrosine phosphorylation", "id": "GO:0018108", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018108", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "platelet aggregation", "id": "GO:0070527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070527", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "collagen-activated tyrosine kinase receptor signaling pathway", "id": "GO:0038063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038063", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "collagen-activated signaling pathway", "id": "GO:0038065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038065", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "collagen binding", "id": "GO:0005518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005518", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "protein tyrosine kinase binding", "id": "GO:1990782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990782", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" }, { "name": "collagen receptor activity", "id": "GO:0038064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038064", "evidence": [ { "database": "UniProtKB", "id": "M0R8A3", "url": "https://www.uniprot.org/uniprot/M0R8A3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" }, { "start_pos": 95, "end_pos": 97, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }