{
    "uniprot_canonical_ac": "L7N1X3-1",
    "uniprot_ac": "L7N1X3",
    "uniprot_id": "L7N1X3_MOUSE",
    "mass": {
        "chemical_mass": 34804.0,
        "monoisotopic_mass": 34804.0
    },
    "refseq": {
        "ac": "NP_997434",
        "name": "olfactory receptor 209",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997434"
    },
    "gene_names": [
        {
            "name": "Or5ac25",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/L7N1X3",
            "id": "L7N1X3"
        },
        {
            "name": "Olfr209",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/L7N1X3",
            "id": "L7N1X3"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "L7N1X3"
        },
        {
            "name": "GA_x54KRFPKG5P-55590495-55589578; olfactory receptor 208; olfactory receptor MOR182-6; GA_x54KRFPKG5P-55580232-55579315",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997434",
            "id": "NP_997434"
        },
        {
            "name": "olfactory receptor 209",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997434",
            "id": "NP_997434"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_997434",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997434"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "L7N1X3",
                    "url": "https://www.uniprot.org/uniprot/L7N1X3"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Or5ac25",
            "url": "https://www.uniprot.org/uniprot/L7N1X3",
            "locus": {
                "chromosome": "16",
                "start_pos": 59181523,
                "end_pos": 59184356,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000095706",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000095706"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000095706",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000095706",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "404311",
            "url": "https://www.ncbi.nlm.nih.gov/gene/404311",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:404311",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:404311",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "3030043",
            "url": "http://www.informatics.jax.org/marker/MGI:3030043",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "CIQFITV",
            "url": "https://omabrowser.org/oma/group/CIQFITV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5401587at2759",
            "url": "http://www.orthodb.org/?query=5401587at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018:SF105",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF105",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018:SF28",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF28",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_997434",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997434",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A140LIQ3",
            "url": "https://www.uniprot.org/uniprot/A0A140LIQ3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A140LIQ3-1",
            "url": "https://www.uniprot.org/uniprot/A0A140LIQ3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "L7N1X3",
            "url": "https://www.uniprot.org/uniprot/L7N1X3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "L7N1X3-1",
            "url": "https://www.uniprot.org/uniprot/L7N1X3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MELNRTQLTEFVLRGITDRSELQVPLFLVFFLIYVITMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFSNKNDMISMGECFAQFYFFCLSATAECFILVAMAYDRYVAICKPLLYVVVMSNRLCIQFIGVSYLIGLLHGLLHVGLLFRLTFCSSNVIDHFYCEILPLYRISCTDPSINVLVAFIMAILIQVSTFMSIIVSYILILFAILRTKSERGRNKAFSTCSSHLSSVSLFYGTLFIIYVLSGSDKDNYQGKMYSLFYTIIIPLLNPFIYSLRNKEVIGALRKLRE",
        "length": 305,
        "header": "tr|L7N1X3-1|L7N1X3_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Or5ac25 PE=3 SV=1 CANONICAL=L7N1X3-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A140LIQ3-1",
            "url": "",
            "sequence": {
                "sequence": "MELNRTQLTEFVLRGITDRSELQVPLFLVFFLIYVITMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFSNKNDMISMASEIKKSSVP",
                "length": 103,
                "header": "tr|A0A140LIQ3-1|L7N1X3_MOUSE Computationally mapped isoform of Olfactory receptor  OS=Mus musculus OX=10090 GN=Or5ac25 PE=3 SV=1 CANONICAL=L7N1X3-1"
            },
            "locus": {
                "chromosome": "16",
                "start_pos": 59182579,
                "end_pos": 59181682,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000213779.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000213779.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000151413.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000151413.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "L7N1X3-1",
            "url": "",
            "sequence": {
                "sequence": "MELNRTQLTEFVLRGITDRSELQVPLFLVFFLIYVITMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFSNKNDMISMGECFAQFYFFCLSATAECFILVAMAYDRYVAICKPLLYVVVMSNRLCIQFIGVSYLIGLLHGLLHVGLLFRLTFCSSNVIDHFYCEILPLYRISCTDPSINVLVAFIMAILIQVSTFMSIIVSYILILFAILRTKSERGRNKAFSTCSSHLSSVSLFYGTLFIIYVLSGSDKDNYQGKMYSLFYTIIIPLLNPFIYSLRNKEVIGALRKLRE",
                "length": 305,
                "header": "tr|L7N1X3-1|L7N1X3_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Or5ac25 PE=3 SV=1 CANONICAL=L7N1X3-1"
            },
            "locus": {
                "chromosome": "16",
                "start_pos": 59182579,
                "end_pos": 59181665,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000208875.3",
                        "url": "https://www.ensembl.org/id/ENSMUST00000208875.3"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000147068.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000147068.2"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "mmu:404311",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:404311",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "odorant binding",
                        "id": "GO:0005549",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "L7N1X3",
                                "url": "https://www.uniprot.org/uniprot/L7N1X3"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 4,
            "end_pos": 6,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}