{ "uniprot_canonical_ac": "J3QNM7-1", "uniprot_ac": "J3QNM7", "uniprot_id": "J3QNM7_MOUSE", "mass": { "chemical_mass": 11422.0, "monoisotopic_mass": 11422.0 }, "refseq": {}, "gene_names": [ { "name": "Atg5lrt", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/J3QNM7", "id": "J3QNM7" }, { "name": "Gm5426", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/J3QNM7", "id": "J3QNM7" } ], "protein_names": [ { "name": "ATP synthase subunit", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "J3QNM7" } ], "function": [ { "annotation": "Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7#function" }, { "database": "UniProtKB", "id": "ARBA00003606", "url": "https://www.uniprot.org/uniprot/ARBA00003606#function" } ] }, { "annotation": "Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7#function" }, { "database": "UniProtKB", "id": "PIRNR017835", "url": "https://www.uniprot.org/uniprot/PIRNR017835#function" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Atg5lrt", "url": "https://www.uniprot.org/uniprot/J3QNM7", "locus": { "chromosome": "10", "start_pos": 95972776, "end_pos": 95972465, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000096486", "url": "https://www.ensembl.org/id/ENSMUSG00000096486" } ] } } ], "crossref": [ { "id": "ENSMUSG00000096486", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000096486", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR006808", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006808", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016702", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016702", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3646788", "url": "http://www.informatics.jax.org/marker/MGI:3646788", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CIGKRHF", "url": "https://omabrowser.org/oma/group/CIGKRHF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR12386", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12386", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12386:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12386:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04718", "url": "http://pfam.xfam.org/family/PF04718", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QNM7-1", "url": "https://www.uniprot.org/uniprot/J3QNM7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKFIHNFSEKALSMVAAAVTYLKPQLVTFWHYAKVELVPPTPGEIPTAIQNVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVLMWFYIGEIMGKRGIVGYDV", "length": 103, "header": "tr|J3QNM7-1|J3QNM7_MOUSE Isoform 1 of ATP synthase subunit OS=Mus musculus OX=10090 GN=Atg5lrt PE=3 SV=1 CANONICAL=J3QNM7-1" }, "isoforms": [ { "isoform_ac": "J3QNM7-1", "url": "", "sequence": { "sequence": "MAKFIHNFSEKALSMVAAAVTYLKPQLVTFWHYAKVELVPPTPGEIPTAIQNVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVLMWFYIGEIMGKRGIVGYDV", "length": 103, "header": "tr|J3QNM7-1|J3QNM7_MOUSE Isoform 1 of ATP synthase subunit OS=Mus musculus OX=10090 GN=Atg5lrt PE=3 SV=1 CANONICAL=J3QNM7-1" }, "locus": { "chromosome": "10", "start_pos": 95972773, "end_pos": 95972465, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000074615.7", "url": "https://www.ensembl.org/id/ENSMUST00000074615.7" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000136869.2", "url": "https://www.ensembl.org/id/ENSMUSP00000136869.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "pmid": "" }, { "name": "mitochondrial proton-transporting ATP synthase complex", "id": "GO:0005753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005753", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "pmid": "" }, { "name": "mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)", "id": "GO:0000276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000276", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proton motive force-driven ATP synthesis", "id": "GO:0015986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015986", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "proton-transporting ATP synthase activity, rotational mechanism", "id": "GO:0046933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046933", "evidence": [ { "database": "UniProtKB", "id": "J3QNM7", "url": "https://www.uniprot.org/uniprot/J3QNM7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 7, "end_pos": 9, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }