{ "uniprot_canonical_ac": "F7FMG9-1", "uniprot_ac": "F7FMG9", "uniprot_id": "F7FMG9_RAT", "mass": { "chemical_mass": 24602.0, "monoisotopic_mass": 24602.0 }, "refseq": {}, "gene_names": [ { "name": "Zfp593", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F7FMG9", "id": "F7FMG9" } ], "protein_names": [ { "name": "Zinc finger protein 593", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F7FMG9" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Zfp593", "url": "https://www.uniprot.org/uniprot/F7FMG9", "locus": { "chromosome": "5", "start_pos": 146462670, "end_pos": 146465198, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000016392", "url": "https://www.ensembl.org/id/ENSRNOG00000016392" } ] } } ], "crossref": [ { "id": "IPR003604", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003604", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022755", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022755", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR46095", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46095", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46095:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46095:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12171", "url": "http://pfam.xfam.org/family/PF12171", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1310179", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310179", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7FMG9-1", "url": "https://www.uniprot.org/uniprot/F7FMG9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVGPAPSGPLLPLQSPVTIWMTTWGRSSSQPARDVIRSSLPSPAPPPGGPFGTSSNGPETPARVGLFLTLVFWSCVCCVCVCVCVSLSLIMGRSRRTGAHRAHSLARQMKAKKRRPDLDEIHRELRPQALPRPKRERDAEPDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTEIPEMDTST", "length": 224, "header": "tr|F7FMG9-1|F7FMG9_RAT Isoform 1 of Zinc finger protein 593 OS=Rattus norvegicus OX=10116 GN=Zfp593 PE=1 SV=1 CANONICAL=F7FMG9-1" }, "isoforms": [ { "isoform_ac": "F7FMG9-1", "url": "", "sequence": { "sequence": "MVGPAPSGPLLPLQSPVTIWMTTWGRSSSQPARDVIRSSLPSPAPPPGGPFGTSSNGPETPARVGLFLTLVFWSCVCCVCVCVCVSLSLIMGRSRRTGAHRAHSLARQMKAKKRRPDLDEIHRELRPQALPRPKRERDAEPDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTEIPEMDTST", "length": 224, "header": "tr|F7FMG9-1|F7FMG9_RAT Isoform 1 of Zinc finger protein 593 OS=Rattus norvegicus OX=10116 GN=Zfp593 PE=1 SV=1 CANONICAL=F7FMG9-1" }, "locus": { "chromosome": "5", "start_pos": 146465155, "end_pos": 146464165, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000021937.6", "url": "https://www.ensembl.org/id/ENSRNOT00000021937.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000021937.5", "url": "https://www.ensembl.org/id/ENSRNOP00000021937.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "preribosome binding", "id": "GO:1990275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990275", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" }, { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" }, { "name": "negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding", "id": "GO:1903026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903026", "evidence": [ { "database": "UniProtKB", "id": "F7FMG9", "url": "https://www.uniprot.org/uniprot/F7FMG9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }