{ "uniprot_canonical_ac": "F1MA87-1", "uniprot_ac": "F1MA87", "uniprot_id": "F1MA87_RAT", "mass": { "chemical_mass": 36952.0, "monoisotopic_mass": 36952.0 }, "refseq": { "ac": "NP_001178790", "name": "cyclin-dependent kinase 6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" }, "gene_names": [ { "name": "Cdk6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F1MA87", "id": "F1MA87" }, { "name": "Cdk6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790", "id": "NP_001178790" } ], "protein_names": [ { "name": "Cyclin-dependent kinase 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F1MA87" }, { "name": "cell division protein kinase 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790", "id": "NP_001178790" }, { "name": "cyclin-dependent kinase 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790", "id": "NP_001178790" } ], "function": [ { "annotation": "A small molecule dual inhibitor of the c-MYC activated kinases ARK5 and CDK4/6, is being developed.", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" }, { "database": "PubMed", "id": "30701428", "url": "https://glygen.org/publication/PubMed/30701428" } ] }, { "annotation": "Results reveal that derepression of CDK6 and activation of Rb pathway contributes to the effect of attenuation of miR-1 on provoking cardiomyocyte hypertrophy", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" }, { "database": "PubMed", "id": "26699910", "url": "https://glygen.org/publication/PubMed/26699910" } ] }, { "annotation": "Taken together, these data suggested that both Nanog may play important roles in spinal cord pathophysiology via interact with CDK6.", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" }, { "database": "PubMed", "id": "26707878", "url": "https://glygen.org/publication/PubMed/26707878" } ] } ], "disease": [ { "disease_id": "DOID:0050902", "recommended_name": { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "medulloblastoma", "description": "An infratentorial cancer that is located_in the lower part of the brain and is a type of primitive neuroectodermal tumor." }, "synonyms": [ { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "CNS PNET", "description": "" }, { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "CPNET", "description": "" }, { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "brain medulloblastoma", "description": "" }, { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "infratentorial primitive neuroectodermal tumor", "description": "" }, { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "localized primitive neuroectodermal tumor", "description": "" }, { "id": "DOID:0050902", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050902", "name": "Medulloblastoma, histologically defined", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma", "description": "A malignant, invasive embryonal neoplasm arising from the cerebellum. It occurs predominantly in children and has the tendency to metastasize via the cerebrospinal fluid pathways. Signs and symptoms include truncal ataxia, disturbed gait, lethargy, headache, and vomiting. There are four histologic variants: classic medulloblastoma, large cell/anaplastic medulloblastoma, desmoplastic/nodular medulloblastoma, and medulloblastoma with extensive nodularity." }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "brain medulloblastoma", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "cerebellar medulloblastoma", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "cerebellum embryonal neoplasm", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma, autosomal recessive, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma, desmoplastic, autosomal recessive, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma, malignant", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma, somatic", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastomas", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "CNS PNET", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "CPNET", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "MDB", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "infratentorial primitive neuroectodermal tumor", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "infratentorial primitive neuroectodermal tumour", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "localised primitive neuroectodermal tumour", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "localized primitive neuroectodermal tumor", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma with extensive nodularity", "description": "" }, { "id": "MONDO:0007959", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007959", "name": "medulloblastoma, desmoplastic", "description": "" }, { "id": "MIM:155255", "resource": "MIM", "url": "https://www.omim.org/entry/155255", "name": "Medulloblastoma", "description": "Medulloblastoma" } ], "evidence": [ { "id": "0050902", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050902" } ] }, { "disease_id": "DOID:0070284", "recommended_name": { "id": "DOID:0070284", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070284", "name": "primary autosomal recessive microcephaly 12", "description": "A primary autosomal recessive microcephaly that has_material_basis_in homozygous or compound heterozygous mutation in the CDK6 gene on chromosome 7q21." }, "synonyms": [ { "id": "DOID:0070284", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070284", "name": "MCPH12", "description": "" }, { "id": "MONDO:0014484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014484", "name": "microcephaly 12, primary, autosomal recessive", "description": "Any autosomal recessive primary microcephaly in which the cause of the disease is a mutation in the CDK6 gene." }, { "id": "MONDO:0014484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014484", "name": "CDK6 autosomal recessive primary microcephaly", "description": "" }, { "id": "MONDO:0014484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014484", "name": "autosomal recessive primary microcephaly caused by mutation in CDK6", "description": "" }, { "id": "MONDO:0014484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014484", "name": "microcephaly 12, primary, autosomal recessive", "description": "" }, { "id": "MONDO:0014484", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014484", "name": "MCPH12", "description": "" }, { "id": "MIM:616080", "resource": "MIM", "url": "https://www.omim.org/entry/616080", "name": "Microcephaly 12, primary, autosomal recessive", "description": "Microcephaly 12, primary, autosomal recessive" } ], "evidence": [ { "id": "0070284", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070284" } ] }, { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] }, { "disease_id": "DOID:3068", "recommended_name": { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma", "description": "A malignant astrocytoma characterized by the presence of small areas of necrotizing tissue that is surrounded by anaplastic cells as well as the presence of hyperplastic blood vessels, and that has_material_basis_in abnormally proliferating cells derives_from multiple cell types including astrocytes and oligondroctyes." }, "synonyms": [ { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "GBM", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "adult glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "grade IV adult Astrocytic tumor", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "primary glioblastoma multiforme", "description": "" }, { "id": "DOID:3068", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3068", "name": "spongioblastoma multiforme", "description": "" } ], "evidence": [ { "id": "3068", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3068" } ] }, { "disease_id": "DOID:3070", "recommended_name": { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "high grade glioma", "description": "A cell type cancer that has_material_basis_in glial cells and is located in brain or located in spine." }, "synonyms": [ { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant glioma", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glial cell tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glioma, malignant", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant Neuroglial tumor", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "GLM1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma, susceptibility to, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "astrocytoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "ependymoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma multiforme", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma of brain, familial", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "oligodendroglioma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "subependymoma", "description": "" }, { "id": "MIM:137800", "resource": "MIM", "url": "https://www.omim.org/entry/137800", "name": "Glioma 1", "description": "Glioma 1" } ], "evidence": [ { "id": "3070", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3070" } ] }, { "disease_id": "DOID:3587", "recommended_name": { "id": "DOID:3587", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3587", "name": "pancreatic ductal carcinoma", "description": "A pancreatic carcinoma located_in the pancreatic duct." }, "synonyms": [ { "id": "DOID:3587", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3587", "name": "malignant neoplasm of duct of Wirsung", "description": "" }, { "id": "DOID:3587", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3587", "name": "pancreatic duct cancer", "description": "" } ], "evidence": [ { "id": "3587", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3587" } ] }, { "disease_id": "DOID:3908", "recommended_name": { "id": "DOID:3908", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3908", "name": "lung non-small cell carcinoma", "description": "A lung carcinoma that is characterized as any type of epithelial lung cancer other than small cell lung carcinoma." }, "synonyms": [ { "id": "DOID:3908", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3908", "name": "NSCLC", "description": "" }, { "id": "DOID:3908", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3908", "name": "Non-small cell lung cancer", "description": "" }, { "id": "DOID:3908", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3908", "name": "non-small cell lung carcinoma", "description": "" } ], "evidence": [ { "id": "3908", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3908" } ] }, { "disease_id": "DOID:3910", "recommended_name": { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "lung adenocarcinoma", "description": "A lung non-small cell carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3910", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "evidence": [ { "id": "3910", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3910" } ] }, { "disease_id": "DOID:4074", "recommended_name": { "id": "DOID:4074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4074", "name": "pancreatic adenocarcinoma", "description": "A pancreatic carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:4074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4074", "name": "pancreas adenocarcinoma", "description": "" } ], "evidence": [ { "id": "4074", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4074" } ] }, { "disease_id": "DOID:7698", "recommended_name": { "id": "DOID:7698", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7698", "name": "non-functioning pancreatic endocrine tumor", "description": "" }, "synonyms": [], "evidence": [ { "id": "7698", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:7698" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cdk6", "url": "https://www.uniprot.org/uniprot/F1MA87", "locus": { "chromosome": "4", "start_pos": 30646460, "end_pos": 30829634, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000009258", "url": "https://www.ensembl.org/id/ENSRNOG00000009258" } ] } } ], "crossref": [ { "id": "ENSRNOG00000009258", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000009258", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07862", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07862", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "114483", "url": "https://www.ncbi.nlm.nih.gov/gene/114483", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017441", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028788", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028788", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:114483", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114483", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TIPRDMG", "url": "https://omabrowser.org/oma/group/TIPRDMG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "244018at2759", "url": "http://www.orthodb.org/?query=244018at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24056", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24056", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24056:SF130", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24056:SF130", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00069", "url": "http://pfam.xfam.org/family/PF00069", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559580", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559585", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-69231", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8934593", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8934593", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9754119", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9754119", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621121", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621121", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6A5X3", "url": "https://www.uniprot.org/uniprot/A0A8I6A5X3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A5X3-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A5X3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MA87-1", "url": "https://www.uniprot.org/uniprot/F1MA87-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAELFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLHSHLSSSQSTSELNTA", "length": 326, "header": "tr|F1MA87-1|F1MA87_RAT Isoform 1 of Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2 CANONICAL=F1MA87-1" }, "isoforms": [ { "isoform_ac": "A0A8I6A5X3-1", "url": "", "sequence": { "sequence": "MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAELFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLVSSWNVVGLCHWDSMTSSVSTLNHVTWE", "length": 306, "header": "tr|A0A8I6A5X3-1|A0A8I6A5X3_RAT Computationally mapped isoform of Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=1 CANONICAL=F1MA87-1" }, "locus": { "chromosome": "4", "start_pos": 30826780, "end_pos": 30648343, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000104799.1", "url": "https://www.ensembl.org/id/ENSRNOT00000104799.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000087481.1", "url": "https://www.ensembl.org/id/ENSRNOP00000087481.1" } ] } }, { "isoform_ac": "F1MA87-1", "url": "", "sequence": { "sequence": "MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAELFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLHSHLSSSQSTSELNTA", "length": 326, "header": "tr|F1MA87-1|F1MA87_RAT Isoform 1 of Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2 CANONICAL=F1MA87-1" }, "locus": { "chromosome": "4", "start_pos": 30826780, "end_pos": 30646987, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000012597.7", "url": "https://www.ensembl.org/id/ENSRNOT00000012597.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000012597.5", "url": "https://www.ensembl.org/id/ENSRNOP00000012597.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "CDK6 mediates the effect of attenuation of miR-1 on provoking cardiomyocyte hypertrophy.", "journal": "Molecular and cellular biochemistry", "date": "2016", "authors": "Yuan W, Tang C, Zhu W, Zhu J, Lin Q, Fu Y, Deng C, Xue Y, Yang M, Wu S, Shan Z", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" } ], "reference": [ { "type": "PubMed", "id": "26699910", "url": "https://glygen.org/publication/PubMed/26699910" } ] }, { "title": "Nanog interact with CDK6 to regulates astrocyte cells proliferation following spinal cord injury.", "journal": "Biochemical and biophysical research communications", "date": "2016", "authors": "Gu J, Ni Y, Xu L, Xu H, Cai Z", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" } ], "reference": [ { "type": "PubMed", "id": "26707878", "url": "https://glygen.org/publication/PubMed/26707878" } ] }, { "title": "Effect of Gender on the Pharmacokinetics of ON 123300, A Dual Inhibitor of ARK5 and CDK4/6 for the Treatment of Cancer, in Rats.", "journal": "European journal of drug metabolism and pharmacokinetics", "date": "2019", "authors": "Mudunuru J, Ren C, Taft DR, Maniar M", "evidence": [ { "database": "RefSeq", "id": "NP_001178790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001178790" } ], "reference": [ { "type": "PubMed", "id": "30701428", "url": "https://glygen.org/publication/PubMed/30701428" } ] } ], "pathway": [ { "id": "rno:114483", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114483", "resource": "KEGG Pathway" }, { "id": "R-RNO-2559580", "name": "Oxidative Stress Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559580", "resource": "Reactome", "description": "Oxidative Stress Induced Senescence" }, { "id": "R-RNO-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-RNO-2559585", "name": "Oncogene Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2559585", "resource": "Reactome", "description": "Oncogene Induced Senescence" }, { "id": "R-RNO-69231", "name": "Cyclin D associated events in G1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69231", "resource": "Reactome", "description": "Cyclin D associated events in G1" }, { "id": "R-RNO-8934593", "name": "Regulation of RUNX1 Expression and Activity", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8934593", "resource": "Reactome", "description": "Regulation of RUNX1 Expression and Activity" }, { "id": "R-RNO-9754119", "name": "Drug-mediated inhibition of CDK4/CDK6 activity", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9754119", "resource": "Reactome", "description": "Drug-mediated inhibition of CDK4/CDK6 activity" } ], "orthologs": [ { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA", "length": 326 }, "evidence": [ { "id": "45228424", "url": "http://www.informatics.jax.org/homology/45228424", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q64261-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "Cdk6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA", "length": 326 }, "evidence": [ { "id": "45228424", "url": "http://www.informatics.jax.org/homology/45228424", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 27, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010389", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of epithelial cell proliferation", "id": "GO:0050680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050680", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "hematopoietic stem cell differentiation", "id": "GO:0060218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060218", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "response to organic substance", "id": "GO:0010033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010033", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "regulation of hematopoietic stem cell differentiation", "id": "GO:1902036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902036", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of cellular senescence", "id": "GO:2000773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000773", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "hemopoiesis", "id": "GO:0030097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030097", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "hematopoietic progenitor cell differentiation", "id": "GO:0002244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002244", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "T cell differentiation in thymus", "id": "GO:0033077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033077", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of osteoblast differentiation", "id": "GO:0045668", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045668", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of cell cycle", "id": "GO:0045786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045786", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "gliogenesis", "id": "GO:0042063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042063", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "regulation of erythrocyte differentiation", "id": "GO:0045646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045646", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cell dedifferentiation", "id": "GO:0043697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043697", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of monocyte differentiation", "id": "GO:0045656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045656", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "negative regulation of myeloid cell differentiation", "id": "GO:0045638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045638", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "type B pancreatic cell development", "id": "GO:0003323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003323", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "positive regulation of cell-matrix adhesion", "id": "GO:0001954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001954", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "kinase activity", "id": "GO:0016301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "FBXO family protein binding", "id": "GO:0098770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098770", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0004693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004693", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cyclin binding", "id": "GO:0030332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030332", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "ruffle", "id": "GO:0001726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001726", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cyclin D2-CDK6 complex", "id": "GO:0097132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097132", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" }, { "name": "cyclin-dependent protein kinase holoenzyme complex", "id": "GO:0000307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000307", "evidence": [ { "database": "UniProtKB", "id": "F1MA87", "url": "https://www.uniprot.org/uniprot/F1MA87" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }