{ "uniprot_canonical_ac": "F1M862-1", "uniprot_ac": "F1M862", "uniprot_id": "F1M862_RAT", "mass": { "chemical_mass": 48013.0, "monoisotopic_mass": 48013.0 }, "refseq": { "ac": "NP_001163941", "name": "carbohydrate sulfotransferase 9", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001163941" }, "gene_names": [ { "name": "Chst9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/F1M862", "id": "F1M862" }, { "name": "Chst9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_008770158", "id": "XP_008770158" } ], "protein_names": [ { "name": "Carbohydrate sulfotransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "F1M862" }, { "name": "2.8.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "F1M862" }, { "name": "carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001163941", "id": "NP_001163941" }, { "name": "carbohydrate sulfotransferase 9 isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_008770158", "id": "XP_008770158" }, { "name": "carbohydrate sulfotransferase 9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001163941", "id": "NP_001163941" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "common_name": "Rat" } ], "gene": [ { "name": "Chst9", "url": "https://www.uniprot.org/uniprot/F1M862", "locus": { "chromosome": "18", "start_pos": 6577348, "end_pos": 6850868, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000015867", "url": "https://www.ensembl.org/id/ENSRNOG00000015867" } ] } } ], "crossref": [ { "id": "ENSRNOG00000015867", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000015867", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "291770", "url": "https://www.ncbi.nlm.nih.gov/gene/291770", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005331", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005331", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018011", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018011", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:291770", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291770", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YRHNANE", "url": "https://omabrowser.org/oma/group/YRHNANE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2907043at2759", "url": "http://www.orthodb.org/?query=2907043at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12137", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12137", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12137:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12137:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03567", "url": "http://pfam.xfam.org/family/PF03567", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001163941", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001163941", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1307302", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1307302", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZVI1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZVI1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZVI1-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZVI1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1M862-1", "url": "https://www.uniprot.org/uniprot/F1M862-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKAKQVFFSVLLFGTAGLLLFMYLQAWVEEHHAGRIEKKREQKGVSVTTGKIQKQSANQNSEVHIPEDLKKKGGNLLNLERPTRVLRKSSHSQRENRAPGSATETYQGAKIRVFQKPILMYWPLATQPLNKSSVQGNKWKKAEATQEKRRSFLREFCKKYGGVNDPKANIFHIVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHDTVHYGKHLKTLDSFDLKGVHMRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNATAKALNNGSGVKFKEFAYYLLDAQRPVGMDIHWERVSKLCYPCLIDYDFVGKFETLEEDANYFLQLIGAPKELKFPNFKDRHSSDERTSAHVVRQYLKDLSAAERQLIYNFYHLDYLMFNYTTPHL", "length": 414, "header": "tr|F1M862-1|F1M862_RAT Isoform 1 of Carbohydrate sulfotransferase OS=Rattus norvegicus OX=10116 GN=Chst9 PE=3 SV=2 CANONICAL=F1M862-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZVI1-1", "url": "", "sequence": { "sequence": "MKAKQVFFSVLLFGTAGLLLFMYLQAWVEEHHAVTTGKIQKQSANQNSEVHIPEDLKKKGGNLLNLERPTRVLRKSSHSQRENRAPGSATETYQGAKIRVFQKPILMYWPLATQPLNKSSVQGNKWKKAEATQEKRRSFLREFCKKYGGVNDPKANIFHIVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHDTVHYGKHLKTLDSFDLKGVHMRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNATAKALNNGSGVKFKEFAYYLLDAQRPVGMDIHWERVSKLCYPCLIDYDFVGKFETLEEDANYFLQLIGAPKELKFPNFKDRHSSDERTSAHVVRQYLKDLSAAERQLIYNFYHLDYLMFNYTTPHL", "length": 401, "header": "tr|A0A8I5ZVI1-1|F1M862_RAT Computationally mapped isoform of Carbohydrate sulfotransferase OS=Rattus norvegicus OX=10116 GN=Chst9 PE=3 SV=1 CANONICAL=F1M862-1" }, "locus": { "chromosome": "18", "start_pos": 6816270, "end_pos": 6577836, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000098563.1", "url": "https://www.ensembl.org/id/ENSRNOT00000098563.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000082918.1", "url": "https://www.ensembl.org/id/ENSRNOP00000082918.1" } ] } }, { "isoform_ac": "F1M862-1", "url": "", "sequence": { "sequence": "MKAKQVFFSVLLFGTAGLLLFMYLQAWVEEHHAGRIEKKREQKGVSVTTGKIQKQSANQNSEVHIPEDLKKKGGNLLNLERPTRVLRKSSHSQRENRAPGSATETYQGAKIRVFQKPILMYWPLATQPLNKSSVQGNKWKKAEATQEKRRSFLREFCKKYGGVNDPKANIFHIVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHDTVHYGKHLKTLDSFDLKGVHMRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNATAKALNNGSGVKFKEFAYYLLDAQRPVGMDIHWERVSKLCYPCLIDYDFVGKFETLEEDANYFLQLIGAPKELKFPNFKDRHSSDERTSAHVVRQYLKDLSAAERQLIYNFYHLDYLMFNYTTPHL", "length": 414, "header": "tr|F1M862-1|F1M862_RAT Isoform 1 of Carbohydrate sulfotransferase OS=Rattus norvegicus OX=10116 GN=Chst9 PE=3 SV=2 CANONICAL=F1M862-1" }, "locus": { "chromosome": "18", "start_pos": 6816270, "end_pos": 6577836, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000021253.7", "url": "https://www.ensembl.org/id/ENSRNOT00000021253.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000021253.6", "url": "https://www.ensembl.org/id/ENSRNOP00000021253.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:291770", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291770", "resource": "KEGG Pathway" }, { "id": "R-RNO-2022870", "name": "Chondroitin sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2022870", "resource": "Reactome", "description": "Chondroitin sulfate biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q76EC5-1", "protein_name": "Carbohydrate sulfotransferase 9", "gene_name": "Chst9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKAKQVFFSVLLFGTAGLLLFMYLQAWIEEHHTGKIEKKRDQKGVSVTTGKIQKQITNQNSEVHMPEDLKKKGGDLLNLGSPTRVLRKISHSQRENGAYRSTEAHQGAKIEVFQKPIQMDWPLVTQPLNKSLVQGNKWKKADATQEKRRSFLHEFCKKYGRVNDPKFNLFHIVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHDTVHYGKHLKTLDSFDLKGVHMRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNASAEALNNGSGVKFKEFAYYLLDAHRPVGMDIHWERVSKLCYPCLINYDFVGKFETLGEDANYFLQLIGAPKELTFPNFKDRHSSDERTNAHVVRQYLKDLSTAERQLIYDFYHLDYLMFNYTTPHL", "length": 413 }, "evidence": [ { "id": "45240817", "url": "http://www.informatics.jax.org/homology/45240817", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7L1S5-1", "protein_name": "Carbohydrate sulfotransferase 9", "gene_name": "CHST9", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRSFLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPCLINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRTERQLIYDFYYLDYLMFNYTTPFL", "length": 443 }, "evidence": [ { "id": "45240817", "url": "http://www.informatics.jax.org/homology/45240817", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "sulfotransferase activity", "id": "GO:0008146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008146", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" }, { "name": "N-acetylgalactosamine 4-O-sulfotransferase activity", "id": "GO:0001537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001537", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "carbohydrate biosynthetic process", "id": "GO:0016051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016051", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" }, { "name": "sulfur compound metabolic process", "id": "GO:0006790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006790", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" }, { "name": "proteoglycan biosynthetic process", "id": "GO:0030166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030166", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "F1M862", "url": "https://www.uniprot.org/uniprot/F1M862" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 130, "end_pos": 132, "annotation": "n_glycosylation_sequon" }, { "start_pos": 214, "end_pos": 216, "annotation": "n_glycosylation_sequon" }, { "start_pos": 287, "end_pos": 289, "annotation": "n_glycosylation_sequon" }, { "start_pos": 295, "end_pos": 297, "annotation": "n_glycosylation_sequon" }, { "start_pos": 408, "end_pos": 410, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-1971483", "name": "Chondroitin can be sulfated on position 4 of GalNAc by CHST9, 11, 12 and 13", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P69478-1", "F1M862-1", "Q498S0-1", "D3ZPV0-1" ], "evidence": [ { "id": "R-RNO-1971483", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1971483" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D3ZPV0", "gene_name": "Chst13", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "D3ZPV0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZPV0" } ] } ] }, { "uniprot_ac": "F1M862", "gene_name": "Chst9", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "F1M862", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M862" } ] } ] }, { "uniprot_ac": "P69478", "gene_name": "Chst11", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "P69478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P69478" } ] }, { "ec_number": "2.8.2.5", "activity": "n 3'-phosphoadenylyl sulfate + chondroitin beta-D-glucuronate = n adenosine 3',5'-bisphosphate + chondroitin 4'-sulfate + n H(+).", "evidence": [ { "id": "P69478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P69478" } ] }, { "ec_number": "2.8.2.5", "activity": "", "evidence": [ { "id": "P69478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P69478" } ] } ] }, { "uniprot_ac": "Q498S0", "gene_name": "Chst12", "activity": [ { "ec_number": "2.8.2.-", "activity": "", "evidence": [ { "id": "Q498S0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q498S0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }